ESTScan Details for Unigene SGN-U280575

Score 
228
Direction 
Forward
Predicted Peptide Sequence 
MGITPDVITYSTLMKAFMRAKKFDQVPKIYSEMESTGCTPDRKAREMLQSALMILEQRHC
Predicted Coding Sequence 
ATGGGTATTACTCCTGATGTGATTACTTATAGCACTTTAATGAAGGCTTTTATGAGGGCTAAGAAGTTTGATCAGGTCCCCAAGATATAT
AGTGAAATGGAATCCACTGGATGTACGCCAGACAGAAAGGCTAGAGAAATGTTGCAATCAGCATTGATGATCCTTGAACAGAGACACTGT
TAG\
Edits in Original Sequence 
CACAATCAATTTACCTGCATATAAAGGAG(5')ATGGGTATTACTCCTGATGTGATTACTTATAGCACTTTAATGAAGGCTTTTATGAGG
GCTAAGAAGTTTGATCAGGTCCCCAAGATATATAGTGAAATGGAATCCACTGGATGTACGCCAGACAGAAAGGCTAGAGAAATGTTGCAA
TCAGCATTGATGATCCTTGAACAGAGACACTGTTAG\(3')TTTAAGTATAAGTAGTTAGCCTTATTAGGCTGTATTGCGGTTTTGTTAG
TTTCTTCAATCAGTAGATGACGCACAGCACCAGAAACTAAAAACACTTTTGATGCTGCTCACTGTAATCTTTGAGGACTTTGATGCTCAA
CTTATCTTTTTAGCTCTTCCTCGTGCCTTATTTATAGGGAGCATTATTTAACCTGTGAGATCATATAGCTTCCTGAAATGTGGATATTGC
AGAGTCACTTGTCATTTTTGAGCAGCCCCAGATGTACTTCTCTTCGTCTGCATTGTTGCTATATCAACAGGAGAGAAAAGCAGCGTCTCT
GAAGGCTAAAAGAGTGTGGTATTGCAGCTGTAGATTCCATTGCTACAATAATGAAGTCTTGTTTCGGACACTGATGCAGAATCTGCAAAT
GACAACACTAAATTAAAGAGGATGCATTCTTTGTAATCATTATTCATGCATATACATTCTTTCTTTATCAGTAAGACTTGGAAATACAAC
AACAATATACCTAGATTGGGGTTTGTACGCAGACCTTATCCCCAATCTCATAGAGAGACTATTTATTAACATTCTTATGGTAATAAATTG
TTGTTGGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan