ESTScan Details for Unigene SGN-U280590

Score 
493
Direction 
Forward
Predicted Peptide Sequence 
MAASPNSSISCSEKKHWWISNRKIVDKYIKDAKFLIATQEPNEIASAVNLLDAALALLPRFELALELKADLYSISGDSKTSPICYKTTFP
XLKMPVDETSSSTSSSGSSDNSSTQFSRERMKLLSSGSGSPGRDEPGFKCFSVSDLKKKVMAGIYKNCDKEGQWRYLVLGQACCHLGLME
DAMVLLQTGKRIATDAFRRESICWSDDSFSFAKFPISGEPGIGNSQPPTPPKTGVGEHFSTAQPYQALASSKDXLQLQALDAGPXIQEAY
KTLFPKIVX
Predicted Coding Sequence 
ATGGCTGCCTCTCCTAATTCTTCTATTTCTTGTTCTGAAAAGAAACATTGGTGGATTAGCAATCGAAAGATTGTTGATAAATATATAAAA
GATGCGAAATTTCTCATTGCTACTCAAGAACCCAACGAGATTGCTTCGGCGGTTAATCTACTCGACGCGGCTCTTGCTCTGTTACCTCGT
TTTGAGTTAGCCCTTGAGTTAAAAGCTGATCTTTACTCTATCTCCGGCGATTCAAAGACGTCGCCGATATGCTACAAGACTACATTCCCA
GXTCTGAAAATGCCCGTCGATGAGACATCGTCGTCGACTTCGTCATCTGGGTCGTCGGATAATTCATCGACACAGTTCTCGAGAGAGAGA
ATGAAGCTACTTTCGTCGGGTAGTGGGTCACCGGGTCGTGATGAACCCGGGTTCAAGTGCTTTTCCGTTTCCGATTTGAAGAAGAAAGTT
ATGGCCGGAATCTACAAAAACTGTGATAAAGAAGGGCAATGGAGGTACTTGGTTCTTGGTCAAGCTTGTTGCCATTTGGGTCTAATGGAA
GATGCAATGGTACTCTTACAGACCGGTAAACGCATTGCTACCGATGCATTCCGTCGCGAAAGCATTTGCTGGTCGGATGATAGTTTTTCA
TTTGCTAAATTTCCAATCTCCGGTGAACCGGGCATTGGAAATAGCCAGCCTCCGACTCCTCCTAAAACXGGAGTCGGAGAGCATTTCTCA
ACTGCTCAGCCATATCAAGCTCTTGCTTCGTCGAAAGACGXGCTGCAATTGCAGGCTCTTGATGCTGGTCCTXTTATTCAAGAAGCCTAT
AAGACACTTTTTCCTAAAATTGTGGXX\
Edits in Original Sequence 
TTCACTTCGAAGAGGAAAAAAATGAGTATTTGAGAAGCTTTCTCTCAAAACCAACAAGTGAAGCATTTTAATGGTTGATCATTATACATC
AACC
(5')ATGGCTGCCTCTCCTAATTCTTCTATTTCTTGTTCTGAAAAGAAACATTGGTGGATTAGCAATCGAAAGATTGTTGATAAAT
ATATAAAAGATGCGAAATTTCTCATTGCTACTCAAGAACCCAACGAGATTGCTTCGGCGGTTAATCTACTCGACGCGGCTCTTGCTCTGT
TACCTCGTTTTGAGTTAGCCCTTGAGTTAAAAGCTcGATCTTTACTCTATCTCCGGCGATTCAAAGACGTCGCCGATATGCTACAAGACT
ACATTCCCAGXTCTGAAAATGCCCGTCGATGAGACATCGTCGTCGACTTCGTCATCTGGGTCGTCGGATAATTCATCGACACAGTTCTCG
AGAGAGAGAATGAAGCTACTTTCGTCGGGTAGTGGGTCACCGGGTCGTGATGAACCCGGGTTCAAGTGCTTTTCCGTTTCCGATTTGAAG
AAGAAAGTTATGGCCGGAATCTACAAAAACTGTGATAAAGAAGGGCAATGGAGGTACTTGGTTCTTGGTCAAGCTTGTTGCCATTTGGGT
CTAATGGAAGATGCAATGGTACTCTTACAGACCGGTAAACGCATTGCTACCGATGCATTCCGTCGCGAAAGCATTTGCTGGTCGGATGAT
AGTTTTTCATTTGCTAAATTTCCAATCTCCGGTGAACCGGGCATTGGAAATAGCCAGCCTCCGACTCCTCCTAAAACXGGAGTCGGAGAG
CATTTCTCAACTGCTCAGCCATATCAAGCTCTTGCTTCGTCGAAAGACGXGCTGCAATTGCAGGCTCTTGATGCTGGTCCTXTTATTCAA
GAAGCCTATAAGACACTTTTTCCTAAAATTGTGGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan