ESTScan Details for Unigene SGN-U280615

Score 
111
Direction 
Forward
Predicted Peptide Sequence 
KEQAKRFTKFRERRGLIEKDVVRTDRSISFYEEDDSPNIKCLRDILLTYSFYNFDLGYCQGMSDLLSPILFVMGDESKHFGALWRMMERL
GTNFNRDQNGMHSTAFLHYPSRWELVGHPSA
Predicted Coding Sequence 
AAGGAGCAGGCAAAAAGATTTACAAAATTCCGAGAGAGGAGAGGCCTCATTGAAAAAGATGTGGTGAGGACTGATCGGTCAATTTCATTC
TATGAAGAGGATGACAGCCCAAACATTAAATGTTTGCGCGATATACTGCTGACATACTCATTCTACAACTTTGATTTGGGTTACTGTCAG
GGTATGAGCGATCTCCTTTCACCAATATTGTTTGTTATGGGAGATGAATCAAAACATTTTGGTGCTTTGTGGCGTATGATGGAACGACTT
GGTACCAACTTTAACCGTGACCAAAATGGAATGCACTCTACAGCTTTTCTGCATTATCCAAGTCGGTGGGAGTTAGTTGGACATCCCTCT
GCATAA\
Edits in Original Sequence 
GATCCTTTCTTTCCAACTTCTGTTTTGATGCTCTTGTAATTTTGATGTTTCATTTGGGAAGTATATCCCTATGTTTTCCTTTTGTCCAGA
AGGCTCCCATGACAAGAAGATGTCTCTGAGATAATTTGTGTTAAAAGTGTAATTTTAATTCTAATGTTTATCGACGCCTCTCTACAGAGC
ATCTCT
(5')AAGGAGCAGGCAAAAAGATTTACAAAATTCCGAGAGAGGAGAGGCCTCATTGAAAAAGATGTGGTGAGGACTGATCGGTC
AATTTCATTCTATGAAGAGGATGACAGCCCAAACATTAAATGTTTGCGCGATATACTGCTGACATACTCATTCTACAACTTTGATTTGGG
TTACTGTCAGGGTATGAGCGATCTCCTTTCACCAATATTGTTTGTTATGGGAGATGAATCAAAACATTTTGGTGCTTTGTGGCGTATGAT
GGAACGACTTGGTACCAtACTTTAACCGTGACCAAAATGGAATGCACTCTACAGCTTTTCTGCATTATCCAAGTCGGTGGGAGTTAGTTG
GACATCCCTCTGCATAA\(3')TTTACTTTCGAACAGAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan