ESTScan Details for Unigene SGN-U280634

Score 
513
Direction 
Forward
Predicted Peptide Sequence 
MGVLEYIASFCTITTSTNNKKKSMQTVEIKVKMDCDGCERRIKNSVKHMKGVKSVEVIRKQSKVIINGYVDPNRVLKKIKSTGKRAEFWP
YVPYNVVYYPHAPQAYDKRAPAGMVKNVPQAFLAPNATEEKFAYLFSDDNPSACSIXVMTVVKI
Predicted Coding Sequence 
ATGGGTGTTTTGGAATATATAGCAAGTTTTTGTACAATCACAACCAGCACAAACAACAAGAAGAAATCAATGCAGACAGTTGAAATAAAA
GTGAAAATGGACTGTGATGGATGTGAAAGAAGAATCAAGAATTCTGTCAAGCATATGAAAGGTGTAAAATCAGTGGAAGTGATTAGAAAG
CAAAGTAAAGTGATAATAAATGGTTATGTGGATCCAAATAGAGTATTGAAGAAAATAAAGAGTACTGGAAAAAGAGCAGAATTTTGGCCA
TATGTACCTTATAATGTGGTATATTATCCACATGCACCACAAGCCTATGATAAAAGGGCACCTGCTGGTATGGTTAAAAATGTGCCACAA
GCATTTCTTGCCCCAAATGCTACTGAAGAAAAATTTGCTTACCTTTTTAGTGATGACAATCCAAGTGCTTGTTCCATTXATGTGATGACG
GTCGTCAAGATTTGA\
Edits in Original Sequence 
TTCTTCCTCTACTATTTATTTCTCTTTTTTTTCTTCTTGCTTAGATTAAAACAACGAGGAGCCAAAATC(5')ATGGGTGTTTTGGAATA
TATAGCAAGTTTTTGTACAATCACAACCAGCACAAACAACAAGAAGAAATCAATGCAGACAGTTGAAATAAAAGTGAAAATGGACTGTGA
TGGATGTGAAAGAAGAATCAAGAATTCTGTCAAGCATATGAAAGGTGTAAAATCAGTGGAAGTGATTAGAAAGCAAAGTAAAGTGATAAT
AAATGGTTATGTGGATCCAAATAGAGTATTGAAGAAAATAAAGAGTACTGGAAAAAGAGCAGAATTTTGGCCATATGTACCTTATAATGT
GGTATATTATCCACATGCACCACAAGCCTATGATAAAAGGGCACCTGCTGGTATGGTTAAAAATGTGCCACAAGCATTTCTTGCCCCAAA
TGCTACTGAAGAAAAATTTGCTTACCTTTTTAGTGATGACAATCCAAGTGCTTGTTCCATTXATGTGATGACGGTCGTCAAGATTTGA\
(3')AGTTTATGGGTTTTGAAGTCATGTCACTATATTTATATAGGTCATCTTAGTTAATGGGTTCATAATTAATAATAAATTTTCTGATAC
AAATATAGAGTCTAAGCAAAAACTGTTCAGTTCTTCTGTTACACATATTAAGATCGTCAAGGTTAGCAGCCACATTCATCGTGTGAATCT
CGAGAAGGATGGCTGCTGCTTTAAAGAAAGAACAACAACGACGACAAATATTTTCACTTATATTTTCATTGATGAGTTTTTTTATAGGGG
GGGGGAGGGTGGGGTGGGGGGGAGGGAGGGTTGCCCTATAAGTATAGCCAGAAGATTTTGATAAATGTAGTATTTACCTTTATGATCATA
CTTAGTGAGTTAAGGAGGGCATGTAAACTGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan