ESTScan Details for Unigene SGN-U280644

Score 
541
Direction 
Forward
Predicted Peptide Sequence 
NQLXGQIGTTILFHGWRGKAEEGIQVLEIFTDFYQKHNYYESEWKDSYRILVDSFMLSSSTFENALSKSLWTMKLSPVGDAVPYSFKDXG
KYDPEIFPIPMFNPHYVRQIVADHEGNVAIKTWDFFVPQFPCYADHPNRFCVCLICWISFFSSSVNIYFFPNPEELEILTREDXTSMFDE
VKGLLFSANTCTSDDEMPTQVLSTKLHSGNQFGWNARMRVATQLASLFAWFHERRYAFGTVRPKDIMIDNDFNIKVFDFGFLTPVTNEDN
WGPLPYHAIREPPEARYGIQNLKADVYIFGILLVELIGNSYIGIEKKMAIHHWILKELQGEKRSIVNESILQDNDELANGITDLAVKCLN
EDPNERPDMMEVSTNLSNLSNLVGAT
Predicted Coding Sequence 
AATCAGCTTXTAGGGCAAATCGGAACCACCATTCTCTTCCATGGATGGCGTGGAAAAGCTGAGGAAGGAATTCAAGTATTGGAAATATTC
ACCGATTTCTATCAAAAGCACAACTATTATGAGTCGGAATGGAAAGACAGTTATCGTATCTTGGTTGATTCGTTTATGCTTAGCTCTTCC
ACATTCGAGAACGCCTTGAGCAAATCTCTTTGGACAATGAAACTGTCACCTGTAGGGGATGCGGTGCCTTACAGCTTTAAGGATXTTGGA
AAATATGACCCTGAAATTTTCCCGATCCCAATGTTTAATCCACACTATGTACGGCAGATTGTTGCAGATCATGAAGGCAATGTTGCTATC
AAAACATGGGATTTCTTTGTTCCACAGTTCCCCTGTTATGCTGACCATCCGAATAGATTTTGTGTATGTTTAATTTGTTGGATCTCATTT
TTCTCTTCCTCCGTTAACATTTATTTTTTCCCTAACCCAGAAGAGCTTGAAATACTAACGCGTGAAGACCXGACATCCATGTTTGATGAA
GTTAAAGGGCTTCTGTTTTCAGCAAATACTTGCACTAGTGATGATGAAATGCCAACACAAGTTTTGTCAACCAAGCTTCATTCTGGCAAT
CAGTTTGGATGGAATGCTAGAATGAGGGTGGCGACTCAACTTGCAAGCCTCTTCGCCTGGTTTCATGAGAGGCGATATGCATTTGGTACT
GTCAGACCAAAAGACATAATGATTGACAACGACTTCAACATTAAAGTATTCGACTTTGGTTTCCTTACTCCGGTCACGAATGAAGATAAT
TGGGGTCCCTTGCCTTATCATGCTATTCGAGAACCTCCAGAGGCTAGATACGGTATTCAGAATTTAAAAGCTGATGTTTACATATTTGGT
ATTCTACTTGTGGAGTTGATTGGCAATAGCTACATTGGTATAGAGAAGAAGATGGCAATCCACCACTGGATTCTTAAGGAACTCCAAGGA
GAAAAAAGATCAATAGTGAATGAATCAATTCTGCAAGATAATGATGAGCTTGCTAACGGCATCACAGACTTAGCAGTAAAATGTTTGAAT
GAGGATCCAAATGAACGCCCAGATATGATGGAAGTCTCTACCAACTTGTCCAACTTGTCCAATTTGGTAGGAGCAACTTGA\
Edits in Original Sequence 
(5')AATCAGCTTXTAGGGCAAATCGGAACCACCATTCTCTTCCATGGATGGCGTGGAAAAGCTGAGGAAGGAATTCAAGTATTGGAAAT
ATTCACCGtATTTCTATCAAAAGCACAACTATTATGAGTCGGAATGGAAAGACAGTTATCGTATCTTGGTTGATTCGTTTATGCTTAGCT
CTTCCACATTCGAGAACGCCTTGAGCAAATCTCTTTGGACAATGAAACTGTCACCTGTAGGGGATGCGGTGCCTTACAGCTTTAAGGATX
TTGGAAAATATGACCCTGAAATTTTCCCGATCCCAATGTTTAATCCACACTATGTACGGCAGATTGtTTGCAGATCATGAAGGCAATGTT
GCTATCAAAACATGGGATTTCTTTGTTCCACAGTTCCCCTGTTATGCTGACCATCCGAATAGATTTTGTGTATGTTTAATTTGTTGGATC
TCATTTTTCTCTTCCTCCGTTAACATTTATTTTTTCCCTAACCCAGAAcGAGCTTGAAATACTAACGCGTGAAGACCXGACATCCATGTT
TGATGAAGTTAAAGGGCTTCTGTTTTCAGCAAATACTTGCACTAGTGtATGATGAAATGCCAACACAAGTTTTGTCAACCAAGCTTCATT
CTGGCAATCAGTTTGGATGGAATGCTAGAATGAGGGTGGCGACTCAACTTGCAAGCCTCTTCGCCTGGTTTCATGAGAGGCGATATGCAT
TTGGTACTGTCAGACCAAAAGACATAATGATTGACAACGACTTCAACATTAAAGTATTCGACTTTGGTTTCCTTACTCCGGTCACGAATG
AAGATAATTGGGGTCCCTTGCCTTATCATGCTATTCGAGAACCTCCAGAGGCTAGATACGGTATTCAGAATTTAAAAGCTGATGTTTACA
TATTTGGTATTCTACTTGTGGAGTTGATTGGCAATAGCTACATTGGTATAGAGAAGAAGATGGCAATCCACCACTGGATTCTTAAGGAAC
TCCAAGGAGAAAAAAGATCAATAGTGAATGAATCAATTCTGCAAGATAATGATGAGCTTGCTAACGGCATCACAGACTTAGCAGTAAAAT
GTTTGAATGAGGATCCAAATGAACGCCCAGATATGATGGAAGTCTCTACCAACTTGTCCAACTTGTCCAATTTGGTAGGAGCAACTTGA\
(3')AATCAATTAGTTACTTTGAGCTTAGTGAGGCTTTATATGCTCAAAACATTACTCAATATGAATCATTAGTTGCTTATGTAATAAGG
ATTTAAGGGGGTGTGGTGGGTCTTATTTTGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan