ESTScan Details for Unigene SGN-U280674

Score 
715
Direction 
Forward
Predicted Peptide Sequence 
MGGGKTTIMVLKVDLQCSSCYKKVKKILCKFPQIRDQVYDEKGNTITITVVCCNPEKLRDKLCSTGCGVIKSIEIKDPPKPKPPEKPKEP
EKPKQPEKPKEPEKPKQPEKPKEPEKPKQPEKPKEPEKPKQPEKPKEPEKPKPKEPETPKEGPKPKPIAPPPDPSARNAKCQFKNDHNRH
TDIVVDNA
Predicted Coding Sequence 
ATGGGGGGTGGAAAGACCACTATCATGGTACTCAAGGTTGATCTTCAATGTTCAAGCTGCTACAAAAAGGTCAAAAAAATTCTCTGTAAA
TTCCCTCAAATTAGAGACCAAGTATATGATGAGAAGGGCAATACAATCACAATCACTGTGGTTTGTTGTAATCCTGAAAAACTTCGTGAC
AAATTGTGTAGTACAGGATGTGGAGTAATCAAAAGCATTGAAATCAAAGACCCTCCAAAGCCCAAACCTCCCGAAAAGCCCAAAGAGCCC
GAAAAGCCCAAACAACCTGAAAAGCCTAAAGAACCCGAAAAGCCCAAACAACCTGAAAAGCCTAAAGAACCCGAAAAGCCCAAACAACCT
GAAAAGCCTAAAGAACCTGAAAAGCCCAAACAACCTGAAAAGCCTAAAGAGCCTGAAAAACCTAAGCCCAAAGAGCCCGAAACGCCCAAA
GAAGGTCCTAAACCTAAACCAATTGCTCCACCACCAGACCCCAGCGCCCGTAATGCCAAATGCCAATTCAAGAATGACCACAACCGCCAC
ACGGATATTGTTGTGGACAATGCX\
Edits in Original Sequence 
ATTTAATTTTAAAGATGTTTTCCTACTTTATTCCTTCTTCTTTTTCTTTTATTTTCTTTTCTTCATAAGACTTTTTGATGTTTCATTCAT
ACTAGTATATATTTTCATTAAAGCTACTCTTTTCACTCCACACAAAATCCATTTTCTTCAAGTATCAACC
(5')ATGGGGGGTGGAAAGA
CCACTATCATGGTACTCAAGGTTGATCTTCAATGTTCAAGCTGCTACAAAAAGGTCAAAAAAATTCTCTGTAAATTCCCTCAAATTAGAG
ACCAAGTATATGATGAGAAGGGCAATACAATCACAATCACTGTGGTTTGTTGTAATCCTGAAAAACTTCGTGACAAATTGTGTAGTACAG
GATGTGGAGTAATCAAAAGCATTGAAATCAAAGACCCTCCAAAGCCCAAACCTCCCGAAAAGCCCAAAGAGCCCGAAAAGCCCAAACAAC
CTGAAAAGCCTAAAGAACCCGAAAAGCCCAAACAACCTGAAAAGCCTAAAGAACCCGAAAAGCCCAAACAACCTGAAAAGCCTAAAGAAC
CTGAAAAGCCCAAACAACCTGAAAAGCCTAAAGAGCCTGAAAAACCTAAGCCCAAAGAGCCCGAAACGCCCAAAGAAGGTCCTAAACCTA
AACCAATTGCTCCACCACCAGACCCCAGCGCCCGTAATGCCAAATGCCAATTCAAGAATGACCACAACCGCCACACGGATATTGTTGTGG
ACAATGCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan