ESTScan Details for Unigene SGN-U280721

Score 
324
Direction 
Forward
Predicted Peptide Sequence 
NFIPKLSDFGLAKSYPTDKSIVTLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLLIDIVGLKTNSAAREDMSSQYFPHWIYDQLDK
GKEIEVLDETHDDVKKLTLVALWCIQMNPLDRPSMTKVVEMLEGELQAXANASQAL
Predicted Coding Sequence 
AATTTCATTCCAAAACTATCTGATTTTGGTCTTGCAAAATCATACCCGACGGATAAGAGCATTGTTACTCTAACAGCAGCCAGGGGAACA
ATTGGTTATGTAGCTCCAGAGTTGATCAACAGAAGCATTGGTCCAATATCTTATAAGGCAGATGTCTATAGCTTTGGAATGTTACTCATT
GATATCGTAGGCTTGAAAACAAACTCGGCAGCCAGAGAGGATATGTCAAGCCAGTATTTCCCACATTGGATTTATGATCAGCTCGACAAG
GGAAAGGAGATTGAAGTACTAGACGAGACACATGATGACGTAAAGAAGCTGACTTTAGTTGCTTTGTGGTGCATACAAATGAATCCACTC
GATCGTCCCTCAATGACTAAAGTAGTGGAAATGCTTGAAGGTGAATTACAAGCAXTTGCAAACGCCTCCCAGGCCCTCTGA\
Edits in Original Sequence 
(5')AATTTCATTCCAAAACTATCTGATTTTGGTCTTGCAAAATCATACCCGACGGATAAGAGCATTGTTACTCTAACAGCAGCCAGGGG
AACAATTGGTTATGTAGCTCCAGAGTTGATCAACAGAAGCATTGGTCCAATATCTTATAAGGCAGATGTCTATAGCTTTGGAATGTTACT
CATTGATATCGTAGGCTTGAAAACAAACTCGGCAGCCAGAGAGGATATGTCAAGCCAGTATTTCCCACATTGGATTTATGATCAGCTCGA
CAAGGGAAAGGAGATTGAAGTACTAGACGAGACACATGATGACGTAAAGAAGCTGACTTTAGTTGCTTTGTGGTGCATACAAATGAATCC
ACTCGATCGTCCCTCAATGACTAAAGTAGTGGAAATGCTTGAAGGTGAATTACAAGCAXTTGCAAACGCCTCCCAGGCCCTCTGA\(3')
ATCGCTGCAAGCATGTTCATTGGAATTCAATCTAATTAGTTCTTCAATAAGCTCAACTGAGTCTGTGAAGTTGCTTGAGAGTTGTTCTGA
TTCAGCAAAAATAGATGTAATTGTTGCTTGACATCACATATTATGTACGTAATTCGTGTTGTTCTGAATAAAATATCAAGTTCATGCTAA
ATTTTAAGATGTTGTTCAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan