ESTScan Details for Unigene SGN-U280727

Score 
552
Direction 
Reverse
Predicted Peptide Sequence 
ADVGDENGETTIDERKIRIKPLPNAKKSNPRISQASVDLSVSNVGLTRSSSYLDAFLDPAFMSLIKDPDQRRREQWEKTAQAQTSWNFFK
MFGYGDVAGPPLSAAEEYSLHSRYLTKANTLNFSEIAEMKIVYRGGVDSEGRPVMVIVGAHFLLRCLDLERFIIHVVKEFEPLIQKPYSI
VYFHSAATLQMQPDLGLMKRIQQILGRKHQHNLHAIYVLHPTFGLKSAVFGLQLCVDNVVWKKVVYVDRLLQLFRYVPREQLTIPDFVFQ
HDLEVNGXKXLIVDPRTKYVYQRT
Predicted Coding Sequence 
GCAGATGTTGGGGATGAAAATGGGGAGACAACTATAGATGAGCGTAAAATTAGGATAAAACCATTACCAAATGCCAAAAAGTCCAATCCA
AGGATTTCCCAGGCCTCTGTTGATTTGTCTGTCAGTAATGTTGGTTTGACCAGGAGCTCATCCTATTTGGATGCTTTTCTGGATCCTGCT
TTTATGTCCCTGATCAAGGACCCAGATCAGCGACGGAGAGAACAATGGGAAAAAACTGCCCAAGCTCAAACTAGCTGGAACTTCTTTAAA
ATGTTTGGATATGGTGACGTCGCAGGACCTCCTTTGTCAGCTGCAGAAGAATATTCTCTTCATTCTAGATATCTTACAAAAGCAAATACT
CTGAATTTTTCAGAAATTGCAGAAATGAAAATTGTCTACCGAGGAGGGGTTGACAGTGAAGGCCGTCCAGTAATGGTTATTGTGGGGGCA
CATTTCCTGCTAAGATGTCTTGATCTGGAGAGATTTATTATCCATGTTGTAAAGGAATTTGAACCATTGATACAGAAACCTTACTCTATT
GTGTACTTCCATTCTGCTGCAACTCTACAGATGCAACCAGATCTAGGATTAATGAAGAGGATACAACAAATTCTTGGTCGCAAGCACCAG
CACAACCTTCATGCGATATATGTTCTTCACCCTACTTTTGGACTGAAGAGTGCAGTTTTTGGTTTACAACTCTGTGTGGATAATGTGGTA
TGGAAGAAAGTAGTATATGTAGATCGTCTTCTGCAACTATTCCGCTATGTTCCTCGTGAACAGCTGACTATTCCTGATTTTGTATTCCAG
CATGATTTGGAAGTGAATGGANGGAAGGNCCTAATTGTGGATCCTAGAACCAAGTATGTTTATCAGAGAACATAG\
Edits in Original Sequence 
(5')GCAGATGTTGGGGATGAAAATGGGGAGACAACTATAGATGAGCGTAAAATTAGGATAAAACCATTACCAAATGCCAAAAAGTCCAA
TCCAAGGATTTCCCAGGCCTCTGTTGATTTGTCTGTCAGTAATGTTGGTTTGACCAGGAGCTCATCCTATTTGGATGCTTTTCTGGATCC
TGCTTTTATGTCCCTGATCAAGGACCCAGATCAGCGACGGAGAGAACAATGGGAAAAAACTGCCCAAGCTCAAACTAGCTGGAACTTCTT
TAAAATGTTTGGATATGGTGACGTCGCAGGACCTCCTTTGTCAGCTGCAGAAGAATATTCTCTTCATTCTAGATATCTTACAAAAGCAAA
TACTCTGAATTTTTCAGAAATTGCAGAAATGAAAATTGTCTACCGAGGAGGGGTTGACAGTGAAGGCCGTCCAGTAATGGTTATTGTGGG
GGCACATTTCCTGCTAAGATGTCTTGATCTGGAGAGATTTATTATCCATGTTGTAAAGGAATTTGAACCATTGATACAGAAACCTTACTC
TATTGTGTACTTCCATTCTGCTGCAACTCTACAGATGCAACCAGATCTAGGATTAATGAAGAGGATACAACAAATTCTTGGTCGCAAGCA
CCAGCACAACCTTCATGCGATATATGTTCTTCACCCTACTTTTGGACTGAAGAGTGCAGTTTTTGGTTTACAACTCTGTGTGGATAATGT
GGTATGGAAGAAAGTAGTATATGTAGATCGTCTTCTGCAACTATTCCGCTATGTTCCTCGTGAACAGCTGACTATTCCTGATTTTGTATT
CCAGCATGATTTGGAAGTGAATGGANGGAAGGNCCTAATTGTGGATCCTAGAACCAAGTATGTTTATCAGAGAACATAG\(3')TCTCAA
ACTTCATCCGATAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan