ESTScan Details for Unigene SGN-U280761

Score 
359
Direction 
Forward
Predicted Peptide Sequence 
RLTRGAATXKSEADSTITSSEKVGIAQQWYDEIDHLAFSTSEIAATIEEATISRGEEIPEGKVEISCSVNSSPGTSEVIICAALYLRLKK
DSDGRSDSRQRKAARIADLLNPGTMVSRDVILQFLLASKRDLEEIIITRPVHVRLKFDCPNHPKADNSKDLILTDTSLNVNVALK
Predicted Coding Sequence 
CGGCTAACTAGAGGGGCAGCAACTGANAAATCCGAAGCAGATAGCACAATTACATCTTCAGAAAAGGTTGGTATTGCCCAGCAATGGTAT
GATGAAATCGACCACCTTGCCTTTTCAACATCAGAAATTGCAGCAACCATAGAAGAGGCAACAATAAGCCGTGGTGAGGAAATTCCAGAA
GGGAAAGTTGAGATAAGTTGCTCCGTTAACTCAAGTCCTGGAACAAGTGAGGTTATCATTTGTGCTGCACTATATCTGAGACTGAAAAAG
GATTCAGATGGCCGTAGTGACAGTAGACAACGGAAAGCAGCCAGGATAGCAGATCTGCTAAACCCCGGGACAATGGTAAGCAGAGATGTA
ATTCTTCAGTTCTTGCTGGCATCAAAAAGAGATCTAGAAGAAATCATCATAACAAGACCTGTACATGTGAGACTCAAGTTTGATTGTCCA
AACCATCCAAAAGCAGATAATTCCAAAGATTTAATTTTGACGGACACCTCTTTAAATGTGAATGTTGCTCTAAAGTAA\
Edits in Original Sequence 
(5')CGGCTAACTAGAGGGGCAGCAACTGANAAtATCCGAAGCAGATAGCACAATTACATCTTCAGAAAAGGTTGGTATTGCCCAGCAAT
GGTATGATGAAATCGACCACCTTGCCTTTTCAACATCAGAAATTGCAGCAACCATAGAAGAGGCAACAATAAGCCGTGGTGAGGAAATTC
CAGAAGGGAAAGTTGAGATAAGTTGCTCCGTTAACTCAAGTCCTGGAACAAGTGAGGTTATCATTTGTGCTGCACTATATCTGAGACTGA
AAAAGGATTCAGATGGCCGTAGTGACAGTAGACAACGGAAAGCAGCCAGGATAGCAGATCTGCTAAACCCCGGGACAATGGTAAGCAGAG
ATGTAATTCTTCAGTTCTTGCTGGCATCAAAAAGAGATCTAGAAGAAATCATCATAACAAGACCTGTACATGTGAGACTCAAGTTTGATT
GTCCAAACCATCCAAAAGCAGATAATTCCAAAGATTTAATTTTGACGGACACCTCTTTAAATGTGAATGTTGCTCTAAAGTAA\(3')AC
CTTTAATAGTGTAGTGTATGACTCTTGAAGATATTCGTGGCTCATTATTTTGTATGAATAAGTGCCTTTGCTGTTCTAATTATCGTGTGT
TCTTAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan