ESTScan Details for Unigene SGN-U280764

Score 
669
Direction 
Forward
Predicted Peptide Sequence 
DFAEYYRSSALHQRNKALVNDLSTPPPGAKDLNFPHNIPSPPGASSSPAYGNNGGLTGEXPDYNLVRFFFSLAAALMIGTIFWNVGSKIE
SSSDLMIVIGAMYAAVLFVGINNCSTVQPIVAVERTVFYRERAAGMYSALPYAMAQVIAEIPYILIQTTYYTLIVYAMIGFDWTAAKFFW
FFFEPSSPSYTGXYYGMMTVSITPNHQVAAIFAAAFYALFNLFSGFFFPDQEFPSGGYGITGSXPVAWTVYGCIVSQYGDVETTITVPNM
SPNPMIKDYIKDHFGYNPDFMAPVAVVLVGFAVFFAFMYSYAIKTLNFQTR
Predicted Coding Sequence 
GATTTTGCTGAATACTACCGATCATCAGCTTTGCATCAACGAAACAAGGCTCTTGTCAATGATTTGAGCACACCTCCTCCTGGAGCCAAA
GACCTCAACTTTCCACACAATATTCCCAGCCCACCTGGGGCCAGTTCAAGTCCTGCTTATGGAAACAATGGTGGACTTACTGGAGAAGXT
CCAGACTATAACCTTGTCAGATTCTTCTTTAGTCTGGCTGCAGCGCTAATGATAGGGACAATTTTCTGGAACGTTGGCAGTAAAATAGAA
AGTAGCAGTGATCTAATGATAGTCATCGGGGCAATGTATGCAGCTGTACTGTTTGTTGGAATCAATAATTGTTCGACTGTACAGCCAATT
GTAGCCGTTGAAAGAACCGTCTTTTATAGAGAAAGGGCTGCTGGGATGTATTCAGCATTACCATATGCTATGGCACAGGTAATTGCAGAA
ATACCATACATACTCATCCAAACAACATACTATACTCTTATAGTGTATGCTATGATCGGCTTTGATTGGACGGCGGCTAAATTCTTCTGG
TTCTTTTTTGAACCTTCTTCTCCTTCCTATACTGGAXCATACTATGGAATGATGACTGTTTCCATCACACCGAACCACCAAGTAGCTGCG
ATCTTTGCTGCAGCATTCTATGCTCTCTTCAATCTTTTCTCCGGTTTCTTCTTCCCAGACCAAGAATTCCCAAGTGGTGGATATGGTATT
ACTGGATCTGXTCCAGTTGCATGGACTGTTTATGGTTGCATTGTATCACAGTATGGTGATGTGGAGACTACTATCACAGTCCCAAATATG
TCTCCAAACCCTATGATTAAGGACTACATTAAAGATCATTTCGGATACAATCCAGACTTCATGGCACCAGTTGCTGTGGTTTTGGTTGGT
TTTGCAGTCTTTTTTGCCTTTATGTACTCTTACGCTATTAAGACATTGAACTTCCAAACAAGATAG\
Edits in Original Sequence 
(5')GATTTTGCTGAATACTACCGATCATCAGCTTTGCATCAACGAAACAAGGCTCTTGTCAATGATTTGAGCACACCTCCTCCTGGAGC
CAAAGACCTCAACTTTaCCACACAATATTCCCAGCCCACCTGGGGCCAGTTCAAGTCCTGCTTATGGAAACAATGGTGGACTTACTGGAG
AAGXTCCAGACTATAACCTTGTCAGATTCTTCTTTAGTCTGGCTGCAGCGCTAATGATAGGGACAATTTTCTGGAACGTTGGCAGTAAAA
TAGAAAGTAGCAGTGATCTAATGATAGTCATCGGGGCAATGTATGCAGCTGTACTGTTTGTTGGAATCAATAATTGTTCGACTGTACAGC
CAATTGTAGCCGTTGAAAGAACCGTCTTTTATAGAGAAAGGGCTGCTGGGATGTATTCAGCATTACCATATGCTATGGCACAGGTAATTG
CAGAAATACCATACATACTCATCCAAACAACATACTATACTCTTATAGTGTATGCTATGATCGGCTTTGATTGGACGGCGGCTAAATTCT
TCTGGTTCTTTTTTGtAACCTTCTTCTCCTTCCTATACTGGAXCATACTATGGAATGATGACTGTTTCCATCACACCGAACCACCAAGTA
GCTGCGATCTTTGCTGCAGCATTCTATGCTCTCTTCAATCTTTTCTCCGGTTTCTTCaTTCCCAGACCAAGAATTCCCAAGTGGTGGATA
TGGTATTACTGGATCTGXTCCAGTTGCATGGACTGTTTATGGTTGCATTGTATCACAGTATGGTGATGTGGAGACTACTATCACAGTCCC
AAATATGTCTCCAAACCCTATGATTAAGGACTACATTAAAGATCATTTCGGATACAATCCAGACTTCATGGCACCAGTTGCTGTGGTTTT
GGTTGGTTTTGCAGTCTTTTTTGCCTTTATGTACTCTTACGCTATTAAGACATTGAACTTCCAAACAAGATAG\(3')ATAGATATGGAT
AGTTACAAAAGCTTGTACATATTGCCTGAAGCCACCTCTTTTCTTCACAAAAGAATGTGGCAATTGTTATAAATTATCTTTAAGAGACAT
AAAAAGGTTCATACACCTCTAGGTCTAGGATCTTTAGTATGTGTTTGTATTTAGGAGTTTTGCAGATAACTATTTCTATAGCACTGAGGA
ATATTCATTCTTGTAAGATTCAAGTGTAGTCTCCTCAGAATAGCACAAAATGTAAGCAATGACTATGCTTCCACAGGGCAAAATGTAATT
GTAAATTACTGATGCTTATATGCAATTAAGATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan