ESTScan Details for Unigene SGN-U280782

Score 
136
Direction 
Forward
Predicted Peptide Sequence 
IFKPHKLKNDTFFSKYEISQERSLQIEEDAFFNFMVVHRDLSKSVIDFSLLIKEKAKCFNXEDDVLKLHHIERILLEWVYQGLVHNLNME
KCNQAYLKSNEQPKIFNDMTNPIDSLXVGEITDSGHYXDDGTVEIIGPIATTVEDTILVLSLVFLIPLHKGAHDXVESLRLGKYAETVKI
VILELHEMRIAHIVSIGSESLCTLNPAXVTGNEQDXKYDTTYKSGTFRSFTAADYVAAX
Predicted Coding Sequence 
XCAATTTTTAAGCCTCACAAATTGAAGAATGACACCTTCTTCTCCAAGTATGAAATTTCTCAAGAACGATCCTTACAGATTGAAGAAGAC
GCATTTTTCAATTTCATGGTTGTTCACCGTGACCTATCAAAATCCGTCATAGATTTCTCGTTGTTAATCAAGGAAAAAGCAAAATGCTTC
AATTAAGAAGATGATGTCTTAAAGCTTCATCACATTGAAAGGATTTTGTTGGAATGGGTTTATCAGGGCTTAGTACACAATTTGAATATG
GAAAAATGCAACCAAGCTTATCTGAAAAGTAATGAACAGCCAAAGATCTTCAATGATATGACAAATCCAATTGATTCTCTTAXAGTTGGA
GAGATTACTGATTCTGGACATTATGXTGATGATGGAACGGTAGAAATTATTGGACCAATAGCCACAACAGTTGAGGACACCATACTTGTT
CTCTCCCTTGTGTTTCTAATTCCCCTTCACAAGGGAGCTCATGATXCTGTGGAATCACTGCGCCTTGGAAAATATGCAGAGACTGTAAAG
ATTGTAATACTAGAGCTGCATGAGATGCGCATTGCTCATATTGTTTCTATTGGGTCTGAATCATTGTGCACATTGAATCCAGCTGANGTG
ACGGGAAATGAGCAAGATXTGAAATATGATACXACGTACAAATCTGGCACTTTTCGTTCATTTACTGCAGCAGACTATGTTGCTGCTCXX
\
Edits in Original Sequence 
(5')XCAATTTTTAAGCCTCACAAATTGAAGAATGACACCTTCTTCTCCAAGTATGAAATTTCTCAAGAACGATCCTTACAGATTGAAGA
AcGACGCATTTTTCAATTTCATGGTTGTTCACCtGTGACCTATCAAAATCCGTCATAGATTTCTCGTTGTTAATCAAGGAAAAAGCAAAA
TGCTTCAATTAAGAAGATGATGTCTTAAAGCTTCATCACATTGAAAGGATTTTGTTGGAATaGGGTTTATCAGGGCTTAGTACACAATTT
GAATATGGAAAAATGCAACCAAGCTTATCTGAAAAGTAATGAACAGCCAAAcGATCTTCAATGATATGACAAATCCAtATTGATTCTCTT
AXAGTTGGAGAGATTACTGATTCTGGACATTATGXTGATGATGGAACGGTAGAAATTATTGGACCAATAGCCACAACAGTTGAGGACACC
ATACTTGTTCTCTCCCTTGTGTTTCTAATTCCCCTTCACAAGGGAGCTCATGATXCTGTGGAATCACTGCGCCTTGGAAAATATGCAGAG
ACTGTAAAGATTGTAATACTAGAGCTGCATGAGATGCGCATTGCTCATATTGTTTCTATTGGGTCTGAATCATTGTGCACATTGAATCCA
GaCTGANGTGACGGGAAATGAGCAAGATXTGAAATATGATACXACGTACAAATCTGGCACTTTTCGTTCATTTACTGCAGCAGACTATGT
TGCTGCTCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan