ESTScan Details for Unigene SGN-U280841

Score 
467
Direction 
Reverse
Predicted Peptide Sequence 
MLLAKILENIYPFSHASPTLPIFPFTQYIPASTDYYPTPPPSSNDLPPXRISSASPTPSDSSSPFLEPQQAKDNTPSCSITTSTPPDNLL
ESVTLQNISMTIFATSDSHSLSLPPTLRLVYIQDGKWPWQRTLRHFEANNTWDIVQLPKGKKALSCKWVYKIKYKQDGTFERFKARLVVQ
GIFKGKVYTSQKRFPCCQNDNLIQQVKKNWHISQLDAVNNVLLHGDLQEEVYMKLLIGMQAPVNLMYVCKLKKSLYDLRQASRQWYARLT
AALNFKGILTLLTTIHSFFMKVQGKVSILAVCVDDILLIGDDPLELESLKFFLNSEFRIKDLGVAYYFXRHGNYQGIILGQRKLTLDLLN
EFGCINLTLVDLFYITLGGSPASWKSKKQS
Predicted Coding Sequence 
ATGTTATTAGCGAAGATCCTTGAAAACATCTATCCATTTTCCCATGCTTCTCCTACTCTCCCTATTTTTCCTTTCACTCAATACATTCCT
GCTTCTACAGATTACTACCCGACTCCTCCTCCTTCCTCTAATGATCTACCACCTGXACGTATCTCTTCTGCATCTCCTACTCCATCAGAC
TCATCTTCTCCTTTTCTTGAGCCTCAGCAAGCTAAAGATAATACTCCTAGTTGTTCAATCACAACATCTACXCCACCAGACAATCTTCTA
GAGTCTGTCACCCTCCAAAATATCTCAATGACTATATTTGCAACTAGTGATTCTCACTCACTGAGCCTACCTCCTACTCTCAGGCTTGTT
TACATCCAGGATGGCAAGTGGCCATGGCAAAGGACTTTGAGGCACTTTGAAGCAAACAATACATGGGACATAGTTCAGTTACCCAAGGGA
AAGAAGGCTTTGTCTTGTAAATGGGTCTATAAAATCAAGTATAAACAAGATGGTACATTTGAAAGATTCAAGGCACGACTAGTTGTGCAG
GGGATATTCAAAGGGAAGGTGTATACTTCACAGAAACGTTTCCCCTGTTGTCAAAATGACAACTTAATTCAGCAAGTGAAGAAGAATTGG
CATATTTCACAACTAGATGCTGTGAATAATGTCTTATTGCATGGTGATTTGCAGGAAGAGGTCTATATGAAGTTGCTTATTGGAATGCAA
GCACCAGTCAATCTCATGTATGTATGCAAGCTTAAAAAGTCTTTATATGATTTGCGACAGGCTTCAAGGCAGTGGTATGCTCGCCTAACT
GCAGCTTTGAATTTCAAGGGTATTCTCACTCTCTTAACGACTATTCACTCTTTCTTTATGAAAGTTCAAGGCAAGGTGTCTATCCTAGCA
GTTTGTGTTGACGACATCCTACTAATCGGGGATGATCCTTTAGAGCTTGAGTCTCTTAAGTTCTTTCTCAACTCTGAGTTTAGAATCAAA
GATTTAGGTGTTGCTTACTATTTCTTXAGGCATGGAAATTATCAGGGTATAATTTTGGGACAAAGAAAACTTACATTGGATTTATTAAAT
GAGTTTGGTTGCATAAACTTGACGCTTGTCGATCTGTTTTACATTACTCTTGGTGGTTCACCTGCCTCATGGAAATCCAAGAAACAATCX
\
Edits in Original Sequence 
TTTTAGAATAATAATATTTTCAATTGATAAATTAAAAATAATCCAAGAAAAATTAGAC(5')ATGTTATaTAGCGAAGATCCTTGAAAAC
ATCTATCCATTTTCCCATGCTTCTCCTACTCTCCCTATTTTTCCTTTCACTCAATACATTCCTGCTTCTACAGATTACTACCCGACTCCT
CCTCCTTCCTCTAATGATCTACCACCTGXACGTATCTCTTCTGCATCTCCTACTCCATCAGACTCATCTTCTCCTTTTCTTGAGCCTCAG
CAAGCTAAgAGATAATACTCCTAGTTGTTCAATCACAACATCTACXCCACCAGACAATCTTCTAGAGTCTGTCACCCTCCAAAATATCTC
AATGACTATATTTGCAACtTAGTGATTCTCACTCACTGAGCCTACCTCCTACTCTCAGGCTTGTTTACATCCAGGATGGCAAGTGGCCAT
GGCAAAGGACTTTGAGGCACTTTGAAGCAAACAATACATGGGACATAGTTCAGTTACCCAAGGGAAAGAAGGCTTTGTCTTGTAAATGGG
TCTATAAAATCAAGTATAAACAAGATGGTACATTTGAAAGATTCAAGGCACGACTAGTTGTGCAGGGGATATTCAAAGGGAAGGTGTATA
CTTCACAGAAACGTaTTCCCCTGTTGTCAAAATGACAACTTAATTCAGCAAGTGAAGAAGAATTGGCATATTTCACAACTAGATGCaTGT
GAATAATGTCTTATTGCATGGTGATTTGCAGGAAGAGGTCTATATGAAGTTGCTTATTGGAATGCAAGCAcCCAGTCAATCTCATGTATG
TATGCAAGCTTAAAAAGTCTTTATATGATTTGCGACAGGCTTCAAGGCAGTGGTATGCTCGCCTAACTGCAGCTTTGAATTTCAAgGGGT
ATTCTCACTCTCTTAACGACTATTCACTCTTTCTTTATGAAAGTTCAAGGCAAGGTGTCTATCCTAGCAGTTTGTGTTGACGACATCCTA
CTAATCGGGGATGATCCTTTAGAGCTTGAGTCTCTTAAGTTCTTTCTCAACTCTGAGTTTAGAATCAAAGATTTAGGTGTTGCTTACTAT
TTCTTXAGGCATGGAAATTATCAGGGTATAATTTTGGGACAAAGAAAACTTACATTGGATTTATTAAATGAGTTTGGTTGCATAAACTTG
ACGCTTGTCGATCTGTTaTTACATTACTCTTGGTGGTTCACCTGCCTCATGGAAATCCAAGAAACAATCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan