Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U280906

Score 
20
Direction 
Forward
Predicted Peptide Sequence 
MAAEAGVDVYYHIHRHPMLGGQNRTESEKRLDGKYFVTDKTGIGTGGHIYPKGKIEIIRHVTYLARGVEALKGLKFPKSLVVVAGLDLSQ
DWQLAYVDGLKNSGHEVNLLYLKQATIGFYFLPNNDHFPCLMDEIRTSSILTVHRXKLTSAIHNKSLTYVTRXFILLRFFVVNRMVFSYM
XDLLHSCGDTSVRTFKSSLQGCRWLDLLDSKARFNVFS
Predicted Coding Sequence 
ATGGCTGCTGAAGCAGGTGTCGATGTATATTACCATATACATCGTCACCCAATGTTGGGGGGGCAAAACAGGACAGAATCTGAGAAGAGA
TTGGACGGGAAATACTTTGTTACCGACAAGACAGGGATTGGTACTGGAGGGCATATCTACCCGAAGGGGAAGATAGAGATCATCCGGCAT
GTAACATATTTGGCTCGAGGAGTAGAAGCXCTCAAAGGACTAAAGTTTCCAAAGAGTCTAGTCGTGGTGGCTGGTTTGGATCTTAGTCAG
GATTGGCAATTGGCATATGTCGATGGTTTGAAGAATTCGGGGCATGAGGTAAATCTCTTGTATCTAAAACAGGCAACAATCGGTTTCTAT
TTCTTGCCAAACAACGATCATTTTCCTTGCCTCATGGACGAGATAAGAACTTCATCCATCCTAACTGTTCATAGAXTTAAGTTAACTTCA
GCTATACATAACAAAAGCTTGACATATGTCACTCGCXGTTTTATTCTTCTTCGTTTCTTTGTAGTGAATAGAATGGTGTTTAGTTATATG
XTAGACTTACTTCACTCTTGTGGTGATACAAGTGTTCGAACCTTCAAGTCATCTCTGCAAGGTTGTCGTTGGCTTGATCTTCTCGATTCT
AAAGCCCGATTTAACGTGTTTTCTTAG\
Edits in Original Sequence 
GAGTAATATTACCACCACGTTGCAGTA(5')ATGGCTGCTGAAGCAGGTGTCGATGTATATTACCATATACATCGTCACCCAATGTTGGG
GGGGCAAAACAGGACAGAATCTGAGAAGAGATTGGACGGGAAATACTTTGTTACCGtACAAGACAGGGATTGGTACTGGAGGGCATATCT
ACCCGAAGGGGAAGATAGAGATCATCCGGCATGTAACATATTTGGCTCGAGGAGTAGAAGCXCTCAAAGGACTAAAGTTTCCAAAGAGTC
TAGTCGTGGTGGCTGGTTTGGATCTTAGTCAGGATTGGCAATTGGCATATGTCGATGGTTTGAAGAATTCGGGGCATGAGGTAAATCTCT
TGTATCTAAAACAGGCAACAATCGGTTTCTATTTCTTGCCAAACAACGATCATTTTCCTTGCCTCATGGACGAGATAAcGAACTTCATCC
ATCCTAACTGTTCATAGAXTTAAGTTAACTTCAGCTATACATAACAAAAGCTTGACATATGTCACTCGCXGTTTTATTCTTCTTCGTTTC
TTTGTAGTGAATAGAATGGTGTTTAGTTATATGXTAGACTTACTTCACTCTTGTGGTGATACAAGTGTTCGAACCTTCAAGTCATCgTCT
GCAAGGTTGTCGTTGGCTTGATCTTCTCGATTCTAAAGCCCGATTTAACGTGTTTTCTTAG\(3')GTGAAGTTAGCTCTCTTTCCTGAG
AATTGTAACTTGTGGAATTGTAATTTTCAGAATATGATGTTGTTGTCAACTTACTTTGTATGTTGTGTTTGAGGAATATATATATAAAGA
TGTTGTTCAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan