ESTScan Details for Unigene SGN-U281074

Score 
285
Direction 
Forward
Predicted Peptide Sequence 
MNESSHPPSVVTYNILINCLCKHGLLDRAIDFFTQMVSENCIPDIITYNTLLRALCKEAMVDEAIQIVHCLGDSSCSPSIITYNIVIDGL
AKLGFMEKAMDLYHQMEKHGTCPDDVTYRCLIWGFCRADLIEEAVELLKEMGNSRHRVRDNCYRFIIHRLCENGKLDSAKQVLKMMISSC
HKLKSTVYSNIVAGIAGAGMNEAAMELRXEVEGMENSQGIDSLFPIRQYPYSVIVIGSMSGADMNKTATEXMEIVEGMQLSRNRGXSYWK
EIIIKSAQQIIRDHLSTNGNFTPLLGFFPCPLSVHFVLGKIFDRVMPA
Predicted Coding Sequence 
ATGAATGAAAGTTCACATCCTCCTAGTGTTGTGACTTACAATATTTTAATCAATTGTTTGTGCAAGCATGGGCTTCTGGATCGTGCAATT
GACTTTTTCACTCAGATGGTCTCTGAAAACTGCATACCTGACATAATCACATATAATACACTTCTACGTGCTCTTTGTAAGGAGGCAATG
GTGGACGAGGCCATCCAAATTGTTCATTGTTTAGGTGATAGCAGTTGTTCTCCTAGTATAATCACTTACAACATAGTCATTGATGGCCTA
GCGAAGCTTGGTTTTATGGAGAAGGCTATGGATTTATACCATCAAATGGAAAAGCATGGGACTTGTCCTGATGATGTTACATATAGATGT
CTAATTTGGGGATTCTGTCGAGCTGATCTTATTGAAGAAGCTGTGGAGTTACTAAAAGAGATGGGTAATAGCAGACACAGGGTCAGAGAT
AATTGTTACAGGTTTATTATTCACAGATTATGCGAAAATGGTAAACTGGACTCTGCAAAACAAGTGCTGAAAATGATGATATCAAGTTGC
CACAAGCTTAAGTCAACCGTATATTCCAATATAGTTGCAGGGATAGCTGGTGCGGGTATGAATGAAGCAGCTATGGAATTGCGTGAXGAA
GTTGAAGGAATGGAAAATTCTCAAGGAATAGATTCTCTTTTCCCAATTAGACAGTATCCTTACTCAGTGATTGTTATTGGTAGCATGTCT
GGTGCAGATATGAATAAAACAGCAACAGAAATXATGGAAATAGTTGAGGGAATGCAACTCTCGAGGAATAGAGGTXTTTCATATTGGAAA
GAGATTATCATTAAGTCAGCACAGCAAATCATTCGAGATCACCTCAGCACAAATGGAAATTTTACTCCTTTATTAGGTTTCTTTCCATGT
CCGTTGTCTGTTCATTTTGTGCTTGGTAAAATTTTTGACCGTGTCATGCCTGCX\
Edits in Original Sequence 
GAGTAGATGAGATTCTTTCCATT(5')ATGAATGAAAGTTCACATCCTCCTAGTGTTGTGACTTACAATATTTTAATCAATTGTTTGTGC
AAGCATGGGCTTCTGGATCGTGCAATTGACTTTTTCACTCAGATGGTCTCTGAAAACTGCATACCTGACATAATCACATATAATACACTT
CTACGTGCTCTTTGTAAGGAGGCAATGGTGGACGAGGCCATCCAAATTGTTCATTGTTTAGGTGATAGCAGTTGTTCTCCTAGTATAATC
ACTTACAACATAGTCATTGATGGCCTAGCGAAGCTTGGTTTTATGGAGAAGGCTATGGATTTATACCATCAAATGGAAAAGCATGGGACT
TGTCCTGATGATGTTACATATAGATGTCTAATTTGGGGATTCTGTCGAGCTGATCTTATTGAAGAAGCTGTGGAGTTACTAAAAGAGATG
GGTAATAGCAGACACAGGGTCAGAGATAATTGTTACAGGTTTATTATTCACAGATTATGCGAAAATGGTAAACTGGACTCTGCAAAACAA
GTGCTGAAAATGATGATATCAAGTTGCCACAAGCTTAAGTCAACCGTATATTCCAATATAGTTGCAGGGATAGCTGGTGCGGGTATGAAT
GAAGCAGCTATGGAATTGCGTGAXGAAGTTGAAGGAATGGAAAATTCTCAAGGAATAGATTCTCTTTTCCCAATTAGACAGTATCCTTaA
CTCAGTGATTGTTATTGGTAGCATGTCTGGTGCAGATATGAATAAAACAGCAACAGAAATXATGGAAATAGTTGAGGGAATGCAACTCTC
GAGGAATAGAGGTXTTTCATATTGGAAAGAGATTATCATTAAGTCAGCACAGCAAATCATTCGAGATCACCTCAGCACAAATGGAAATTT
TACTCCTTTATTAGGTTTCTTTCCATGTCCGTTGTCTGTTCtATTTTGTGCTTGGTAAAATTTTTGACCGTGTCATGCCTGCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan