ESTScan Details for Unigene SGN-U281203

Score 
228
Direction 
Forward
Predicted Peptide Sequence 
METKVISSGIHHSTLPQSYIRPESDRPRLSDVVDCENVPIIDLGCGDHAQIIRLIGEACQTYGFFQVINHGVPKEVVEQMLRVAGEFFNL
PVEEKLKLYSDDPSKTMRLSTSFNIKKETVHNWRDYLRLHCYPLEKYAPEWPSNPSSFREIVSRICTEVRQLGFRLEEAIXESLGX
Predicted Coding Sequence 
ATGGAAACGAAAGTTATTTCGAGCGGAATCCACCACTCTACTCTCCCTCAAAGTTACATCCGACCCGAATCCGATAGGCCACGTCTATCG
GATGTGGTCGATTGTGAAAATGTTCCAATAATTGACTTAGGTTGCGGAGACCATGCTCAAATAATCCGTCTAATTGGAGAAGCTTGTCAA
ACTTATGGTTTCTTTCAGGTAATTAATCATGGTGTACCAAAGGAAGTTGTAGAGCAAATGCTAAGGGTAGCTGGGGAATTTTTCAATTTA
CCAGTAGAAGAGAAGCTAAAATTGTATTCAGATGATCCTTCAAAGACCATGAGATTATCTACTAGTTTTAATATTAAAAAGGAGACAGTT
CATAATTGGAGAGATTATCTCAGACTTCATTGTTATCCTCTGGAGAAATATGCTCCTGAATGGCCTTCTAATCCATCGTCTTTCAGGGAA
ATCGTGAGCAGAATTTGCACGGAAGTTCGACAACTCGGATTTAGATTGGAGGAAGCCATANCAGAGAGCCTGGGCTTX\
Edits in Original Sequence 
GAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGA
GAAATCTTCTTCATTTGTAATTCACAAATTATTAGTCCTTTTTTTTTTTTTTTCCAATTTAATTATATTTATTTGCTACGCCATATATAT
TTAATATCAATAGAATCC
(5')ATGGAAACGAAAGTTATTTCGAGCGGAATCCACCACTCTACTCTCCCTCAAAGTTACATCCGACCCGA
ATCCGATAGGCCACGTCTATCGGATGTGGTCGATTGTGAAAATGTTCCAATAATTGACTTAGGTTGCGGAGACCATGCTCAAATAATCCG
TCTAATTGGAGAAGCTTGTCAAACTTATGGTTTCTTTCAGGTAATTAATCATGGTGTACCAAAGGAAGTTGTAGAGCAAATGCTAAGGGT
AGCTGGGGAATTTTTCAATTTACCAGTAGAAGAGAAGCTAAAATTGTATTCAGATGATCCTTCAAAGACCATGAGATTATCTACTAGTTT
TAATATTAAAAAGGAGACAGTTCATAATTGGAGAGATTATCTCAGACTTCATTGTTATCCTCTGGAGAAATATGCTCCTGAATGGCCTTC
TAATCCATCGTCTTTCAGGGAAATCGTGAGCAGAATTTGCACGGAAGTTCGACAACTCGGATTTAGATTGGAGGAAGCCATANCAGAGAG
CCTGGGCTTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan