ESTScan Details for Unigene SGN-U281209

Score 
489
Direction 
Forward
Predicted Peptide Sequence 
MASSIVSSAAVATRSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEY
LLKNGWVPCLEFETEHGFVYREHNSSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG
Y
Predicted Coding Sequence 
ATGGCTTCCTCAATTGTCTCCTCAGCAGCCGTTGCTACCCGTAGCAATGTTGCTCAAGCTAGCATGGTCGCACCCTTCACCGGACTCAAA
TCCGCCGCGTCTTTCCCCGTTACTAAGAAGAACAACAACGTTGACATTACTTCCCTTGCTAGCAACGGTGGACGTGTTAGATGCATGCAG
GTGTGGCCACCAATTAACATGAAGAAATACGAGACATTGTCATACCTTCCTGACTTGTCCGATGAGCAATTGCTTAAGGAAGTTGAGTAC
CTTTTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGAGACTGAGCACGGATTTGTGTACCGTGAGCACAACAGCTCACCAGGATACTAC
GATGGTAGATACTGGACCATGTGGAAGTTGCCTATGTTTGGGTGCACTGACGCAACCCAGGTGTTGGCTGAGGTTCAAGAGGCCAAGAAG
GCGTACCCACAGGCCTGGATCCGTATTATCGGATTCGACAACGTTCGTCAAGTGCAGTGCATCAGTTTCATTGCCTACAAGCCAGAAGGA
TACTAA\
Edits in Original Sequence 
GTTTCTTTGAAGTAAAAAAAAAAAAAAACGTTTTATAGCTAAGTAGTAACGTA(5')ATGGCTTCCTCAATTGTCTCCTCAGCAGCCGTT
GCTACCCGTAGCAATGTTGCTCAAGCTAGCATGGTCGCACCCTTCACCGGACTCAAATCCGCCGCGTCTTTCCCCGTTACTAAGAAGAAC
AACAACGTTGACATTACTTCCCTTGCTAGCAACGGTGGACGTGTTAGATGCATGCAGGTGTGGCCACCAATTAACATGAAGAAATACGAG
ACATTGTCATACCTTCCTGACTTGTCCGATGAGCAATTGCTTAAGGAAGTTGAGTACCTTTTGAAAAATGGATGGGTTCCTTGCTTGGAA
TTCGAGACTGAGCACGGATTTGTGTACCGTGAGCACAACAGCTCACCAGGATACTACGATGGTAGATACTGGACCATGTGGAAGTTGCCT
ATGTTTGGGTGCACTGACGCAACCCAGGTGTTGGCTGAGGTTCAAGAGGCCAAGAAGGCGTACCCACAGGCCTGGATCCGTATTATCGGA
TTCGACAACGTTCGTCAAGTGCAGTGCATCAGTTTCATTGCCTACAAGCCAGAAGGATACTAA\(3')ATTTCATCAAACCTATAATTAA
TTACTCCTATCGACATGTTTTTTGCGTTTTGTACCGGTGTATTTTCCTCGATTCCGACCAAGTTATGAGAAATTAATAATGATGAATCTT
TAATTAATTCGACCAAGTTATGAGATATTAATAATGATGAATCGGTGCTTATATGTTTTAAAAAAAAAAAAAAAAAANNNNACCCTGTGT
GTCACTCCAGCAGAGCAGATAAAGCTATAAGAATGCAAGCTGCCAGTCTCGCCTTTCACCCTCCGGCACTCCATACTTCACCTTCTTACT
TCTCCTCCAAACTTCCCCA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan