ESTScan Details for Unigene SGN-U281221

Score 
984
Direction 
Forward
Predicted Peptide Sequence 
ADAPNPNPNSPXRTQLFRQFPTESSKMGDTKENEAYEEELLDYEEDDEKAPDSVNGKVNGESAKKGYVGIHSSGFRDFLLKPELLRAIVD
SGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVPGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV
NIKLHKELLKNECPHVVVGTPGRVLALAREKDLSLKNVRHFILDECDKMLDSLDMRRDVQAIFKMTPHDKQVMMFSATLSKEIRPVCKKF
MQDPMEIYVDDEAKLTLHGLVQHYIKLSETEKNRKLNDLLDALDFNQVVIFVKSVNRAAELNKLLAECNFPSICIHSGMTX
Predicted Coding Sequence 
GCAGACGCTCCAAACCCTAACCCTAATTCGCCGXCAAGAACTCAGCTTTTCCGGCAGTTTCCAACTGAAAGTAGCAAGATGGGAGATACA
AAGGAAAACGAAGCTTACGAGGAAGAACTTCTCGACTACGAAGAAGATGATGAGAAGGCCCCAGATTCCGTTAATGGAAAAGTAAACGGC
GAGTCTGCCAAGAAGGGTTATGTTGGAATTCACAGTTCTGGATTCAGAGACTTTCTTTTAAAGCCAGAGCTACTGCGGGCTATTGTGGAT
TCAGGGTTTGAGCATCCCTCTGAAGTGCAACATGAGTGTATTCCACAAGCTATTCTGGGTATGGATGTTATTTGTCAAGCCAAATCTGGA
ATGGGCAAAACTGCTGTTTTTGTTCTTTCGACTCTGCAGCAGATTGAACCTGTTCCTGGTCAGGTTGCTGCTTTGGTCTTATGTCATACA
AGGGAATTAGCTTATCAGATCTGTCATGAATTTGAGAGGTTCAGCACATATTTGCCTGATATCAAGGTTGCTGTCTTCTATGGTGGTGTC
AATATCAAACTTCACAAGGAGCTTCTGAAGAATGAATGTCCTCATGTTGTTGTTGGAACTCCTGGAAGAGTACTTGCATTGGCTAGAGAG
AAAGACCTATCTCTGAAGAATGTGAGGCATTTTATTCTGGATGAATGTGACAAGATGCTTGATTCACTTGATATGAGGAGAGATGTGCAG
GCAATCTTCAAGATGACTCCCCATGACAAGCAAGTAATGATGTTTTCAGCAACACTCAGCAAGGAGATACGTCCAGTCTGCAAAAAATTT
ATGCAAGATCCAATGGAGATTTATGTTGACGATGAGGCAAAGTTGACCCTTCATGGACTTGTACAGCATTACATCAAATTGAGTGAAACG
GAGAAAAACCGGAAGCTAAATGATCTGCTGGATGCCTTGGACTTCAATCAAGTAGTTATATTTGTCAAGAGCGTGAACAGAGCAGCAGAG
CTGAATAAATTACTAGCGGAGTGTAATTTTCCATCTATCTGCATCCACTCTGGCATGACTCXX\
Edits in Original Sequence 
GAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGCTA
ACATTTTTTTCT
(5')GCAGACGCTCCAAACCCTAACCCTAATTCGCCGXCAAGAACTCAGCTTTTCCGGCAGTTTCCAACTGtAAAGTA
GCAAGATGGGAGATACAAAGGAAAACGAAGCTTACGAGGAAGAACTTCTCGACTACGAAGAAGATGATGAGAAGGCCCCAGATTCCGTTA
ATGGAAAAGTAAACGGCGAGTCTGCCAAGAAGGGTTATGTTGGAATTCACAGTTCTGGATTCAGAGACTTTCTTTTAAAGCCAGAGCTAC
TGCGGGCTATTGTGGATTCAGGGTTTGAGCATCCCTCTGAAGTGCAACATGAGTGTATTCCACAAGCTATTCTGGGTATGGATGTTATTT
GTCAAGCCAAATCTGGAATGGGCAAAACTGCTGTTTTTGTTCTTTCGACTCTGCAGCAGATTGAACCTGTTCCTGGTCAGGTTGCTGCTT
TGGTCTTATGTCATACAAGGGAATTAGCTTATCAGATCTGTCATGAATTTGAGAGGTTCAGCACATATTTGCCTGATATCAAGGTTGCTG
TCTTCTATGGTGGTGTCAATATCAAACTTCACAAGGAGCTTCTGAAGAATGAATGTCCTCATGTTGTTGTTGGAACTCCTGGAAGAGTAC
TTGCATTGGCTAGAGAGAAAGACCTATCTCTGAAGAATGTGAGGCATTTTATTCTGGATGAATGTGACAAGATGCTTGATTCACTTGATA
TGAGGAGAGATGTGCAGGCAATCTTCAAGATGACTCCCCATGACAAGCAAGTAATGATGTTTTCAGCAACACTCAGCAAGGAGATACGTC
CAGTCTGCAAAAAATTTATGCAAGATCCAATGGAGATTTATGTTGACGATGAGGCAAAGTTGACCCTTCATGGACTTGTACAGCATTACA
TCAAATTGAGTGAAACGGAGAAAAACCGGAAGCTAAATGATCTGCTGGATGCCTTGGACTTCAATCAAGTAGTTATATTTGTCAAGAGCG
TGAACAGAGCAGCAGAGCTGAATAAATTACTAGCGGAGTGTAATTTTCCATCTATCTGCATCCACTCTGGCATGACTCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan