ESTScan Details for Unigene SGN-U281245

Score 
1312
Direction 
Forward
Predicted Peptide Sequence 
MATSAIQQSAFVGQAVGKSQNEFVRKVGSFGEGRITMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPET
FARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGP
LGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHINDPVANNAWAYATNFVPGK
Predicted Coding Sequence 
ATGGCCACTTCTGCAATTCAACAATCAGCCTTTGTTGGTCAAGCAGTTGGTAAATCTCAAAATGAGTTTGTTAGGAAAGTTGGCAGCTTC
GGTGAAGGCCGTATTACCATGAGGCGTACTGTTAAAAGCGCTCCTCAAAGCATCTGGTACGGAGAAGACCGTCCTAAGTACTTGGGCCCA
TTTTCTGAGCAAACACCATCATACTTGACTGGTGAATTCCCAGGTGACTACGGATGGGACACGGCTGGACTTTCTGCTGACCCAGAGACA
TTTGCTAGAAACCGTGAGCTTGAGGTGATCCATTGCCGTTGGGCTATGCTTGGTGCTTTGGGCTGTGTTTTCCCCGAAATCCTTTCGAAG
AACGGTGTTAAATTCGGTGAGGCTGTTTGGTTCAAGGCTGGATCTCAGATTTTCTCAGAAGGTGGGCTTGACTACCTTGGAAACCCAAAC
CTTGTCCATGCCCAAAGCATTCTTGCCATTTGGGCCTGCCAAGTTGTTCTTATGGGCTTTGTTGAAGGTTACAGAGTTGGTGGAGGCCCA
CTTGGTGAGGGTCTTGACAAGATCTACCCAGGAGGTGCCTTTGACCCACTCGGTCTTGCTGATGATCCCGAGGCTTTTGCTGAATTGAAG
GTCAAGGAAATTAAGAACGGACGTTTGGCTATGTTCTCCATGTTTGGATTCTTTGTTCAAGCTATTGTCACTGGAAAGGGCCCAATTGAG
AACCTTTCTGACCACATTAATGACCCAGTGGCTAACAACGCTTGGGCTTACGCCACAAACTTTGTACCTGGAAAGTGA\
Edits in Original Sequence 
GAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGA
GAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGACAAAAAAGAAAAACTTCAGCAAATTAAAAAAAAAA
(5')ATGGCCACTTC
TGCAATTCAACAATCAGCCTTTGTTGGTCAAGCAGTTGGTAAATCTCAAAATGAGTTTGTTAGGAAAGTTGGCAGCTTCGGTGAAGGCCG
TATTACCATGAGGCGTACTGTTAAAAGCGCTCCTCAAAGCATCTGGTACGGAGAAGACCGTCCTAAGTACTTGGGCCCATTTTCTGAGCA
AACACCATCATACTTGACTGGTGAATTCCCAGGTGACTACGGATGGGACACGGCTGGACTTTCTGCTGACCCAGAGACATTTGCTAGAAA
CCGTGAGCTTGAGGTGATCCATTGCCGTTGGGCTATGCTTGGTGCTTTGGGCTGTGTTTTCCCCGAAATCCTTTCGAAGAACGGTGTTAA
ATTCGGTGAGGCTGTTTGGTTCAAGGCTGGATCTCAGATTTTCTCAGAAGGTGGGCTTGACTACCTTGGAAACCCAAACCTTGTCCATGC
CCAAAGCATTCTTGCCATTTGGGCCTGCCAAGTTGTTCTTATGGGCTTTGTTGAAGGTTACAGAGTTGGTGGAGGCCCACTTGGTGAGGG
TCTTGACAAGATCTACCCAGGAGGTGCCTTTGACCCACTCGGTCTTGCTGATGATCCCGAGGCTTTTGCTGAATTGAAGGTCAAGGAAAT
TAAGAACGGACGTTTGGCTATGTTCTCCATGTTTGGATTCTTTGTTCAAGCTATTGTCACTGGAAAGGGCCCAATTGAGAACCTTTCTGA
CCACATTAATGACCCAGTGGCTAACAACGCTTGGGCTTACGCCACAAACTTTGTACCTGGAAAGTGA\(3')AGTAATTAGTAGTATGTA
ATCTGTAAAATTTGGGCTAATTAATGAAGTTTTTATGCTTGTGAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan