ESTScan Details for Unigene SGN-U281330

Score 
811
Direction 
Forward
Predicted Peptide Sequence 
MATSAIQQSAFVGQAVGKSQNEFVRKVGSFGEGRITMRRTVKALLKASGISFYPNLFFEIFLQYYKYNHPVILKFQSEELLIDFFYFYEX
RYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIF
SEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDQIYPGGGLLEPNSGLALNDPEGLLLEFEGEGXLRMDRLAMFS
MFGFFVQAIVTGKGPIENLSDHINDPVANNAWAYATNFVPGK
Predicted Coding Sequence 
ATGGCCACTTCTGCAATTCAACAATCAGCCTTTGTTGGTCAAGCAGTTGGTAAATCTCAAAATGAGTTTGTTAGGAAAGTTGGCAGCTTC
GGTGAAGGCCGTATTACCATGAGGCGTACTGTTAAAGCGCTCCTCAAAGCATCTGGTATTTCTTTCTATCCAAATTTATTTTTTGAAATA
TTTCTACAGTATTATAAATACAATCATCCAGTAATTTTGAAATTTCAATCTGAGGAACTTTTAATTGATTTTTTTTATTTTTATGAAATX
AGGTACGGAGAAGACCGTCCTAAGTACTTGGGCCCATTTTCTGAGCAAACACCATCATACTTGACTGGTGAATTCCCAGGTGACTACGGA
TGGGACACGGCTGGACTTTCTGCTGACCCAGAGACATTTGCTAGAAACCGTGAGCTTGAGGTGATCCATTGCCGTTGGGCTATGCTTGGT
GCTTTGGGCTGTGTTTTTCCCGAAATCCTTTCGAAAAACGGTGTTAAATTCGGTGAGGCTGTTTGGTTCAAGGCTGGATCTCAGATTTTC
TCAGAAGGTGGGCTTGACTACCTTGGAAACCCAAACCTTGTCCATGCCCAAAGCATTCTTGCCATTTGGGCCTGCCAAGTTGTTCTTATG
GGCTTTGTTGAAGGTTACAGAGTTGGTGGAGGCCCACTTGGTGAGGGTCTTGACCAGATCTACCCAGGAGGTGGCCTTTTGGAACCCAAC
TCGGGTCTTGCXCTGAATGATCCCGAGGGCCTTTTGCTGGAATTTGAAGGTGAAGGAAXATTAAGAATGGACCGTTTGGCTATGTTCTCC
ATGTTTGGATTCTTTGTTCAAGCTATTGTCACTGGAAAGGGCCCAATTGAGAACCTTTCTGACCACATTAATGACCCAGTGGCTAACAAC
GCTTGGGCTTACGCCACAAACTTTGTACCTGGAAAGTGA\
Edits in Original Sequence 
AGAAAAACTTCAGCAAATTAAAAAAAAAA(5')ATGGCCACTTCTGCAATTCAACAATCAGCCTTTGTTGGTCAAGCAGTTGGTAAATCT
CAAAATGAGTTTGTTAGGAAAGTTGGCAGCTTCGGTGAAGGCCGTATTACCATGAGGCGTACTGTTaAAAGCGCTCCTCAAAGCATCTGG
TATTTCTTTCTATCCAAATTTATTTTTTGAAATATTTCTACtAGTATTATAAATACAATCATCCAGTAATTTTGAAATTTCAATCTGAGG
AACTTTTAATTGATTTTTTTTATTTTTATGAAATXAGGTACGGAGAAGACCGTCCTAAGTACTTGGGCCCATTTTCTGAGCAAACACCAT
CATACTTGACTGGTGAATTCCCAGGTGACTACGGATGGGACACGGCTGGACTTTCTGCTGACCCAGAGACATTTGCTAGAAACCGTGAGC
TTGAGGTGATCCATTGCCGTTGGGCTATGCTTGGTGCTTTGGGCTGTGTTTTTCCCGAAATCCTTTCGAAAAACGGTGTTAAATTCGGTG
AGGCTGTTTGGTTCAAGGCTGGATCTCAGATTTTCTCAGAAGGTGGGCTTGACTACCTTGGAAACCCAAACCTTGTCCATGCCCAAAGCA
TTCTTGCCATTTGGGCCTGCCAAGTTGTTCTTATGGGCTTTGTTGAAGGTTACAGAGTTgGGTGGAGGCCCACTTGGTGAGGGTCtTTGA
CCAGATCTACCCAGGAGGTGGCCTTTTGGAACCCAACTCGGGTCTTGCXCTGAATGATCCCGAGGGCCTTTTGCTGGAATTTGAAGGTGA
AGGAAXATTAAGAATGGACCGTTTGGCTATGTTCTCCATGTTTGGATTCTTTGTTCAAGCTAtTTGTCACTGGAAAGGGCCCAATTGAGA
ACCTTTCTGACCACATTAATGACCCAGTGGCTAACAACGCTTGGGCTTACGCCACAAACTTTGTACCTGGAAAGTGA\(3')AGTAATTA
GTAGTATGTAATCTGTAAAATTTGGGCTAATTAATGAAGTTTTTAAGCTTGTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan