ESTScan Details for Unigene SGN-U281371

Score 
762
Direction 
Forward
Predicted Peptide Sequence 
MAENSGKGIGRNSGTSRVALXMKEFSPQCHEDXIAAHPWHDLEIGPGAPSIFNCVVEIGKGSKVKYELDKASGLIKVDRILYSSVVYPHN
YGFIPRTLCEDSDPMDVLVLMQEPVLPSTFLRARAIGLMPMIDQGEKDDKIIAVCADDPEFRHYTDIKELPPHRLAEIRRFFEDYKKNEN
KSVAVEDFLPAEAAVDAIKYSMDLYASYIVESLGSDLVEDMLLXMTENQVEKPVXLVEDGSLNFNAYFSLMWYYQIPFEMHVELSIFMYS
EKIGTEASRKPLVMCSGGAVEKMLAQHLKNLTIKKKKKGTGPCGXLPMFGCTDATQVLAEVQECKKSYPQAWIRIIGFDNVLKCSVSVSL
PTSQKATKFHIRNKIVFRDTLFLNAT
Predicted Coding Sequence 
ATGGCTGAAAATAGTGGAAAAGGGATCGGAAGAAACTCAGGAACCTCTCGTGTTGCACTTXTAATGAAAGAATTCTCTCCTCAATGTCAC
GAAGATXCTATTGCTGCTCATCCGTGGCATGACCTAGAGATTGGGCCAGGTGCACCTTCAATTTTCAACTGTGTGGTTGAAATAGGCAAA
GGCAGCAAAGTCAAGTATGAGCTTGACAAAGCAAGTGGCCTTATAAAGGTTGACCGAATACTGTACTCATCAGTTGTTTATCCACACAAC
TATGGTTTCATCCCAAGAACCCTTTGTGAAGACAGTGATCCAATGGACGTCTTGGTACTGATGCAGGAACCTGTGTTACCAAGTACCTTT
CTTCGTGCTCGTGCAATTGGATTGATGCCTATGATTGATCAGGGTGAGAAAGATGACAAGATAATAGCAGTGTGTGCAGATGATCCTGAG
TTTCGCCACTACACAGACATCAAGGAGCTCCCTCCTCATCGTCTTGCTGAAATCCGGCGCTTTTTTGAAGACTATAAAAAGAATGAGAAC
AAGTCAGTTGCAGTTGAGGACTTTCTGCCTGCTGAAGCAGCTGTAGATGCCATCAAGTATTCCATGGACTTGTATGCTTCTTACATTGTG
GAAAGTTTGGGAAGTGACCTTGTTGAGGACATGTTGTTGXTCATGACTGAAAATCAAGTAGAGAAGCCGGTTGAXCTTGTTGAAGATGGC
TCCCTGAATTTCAATGCGTACTTTAGTTTAATGTGGTATTATCAAATACCATTTGAAATGCATGTAGAACTTTCAATTTTCATGTATTCA
GAAAAGATTGGAACAGAAGCATCAAGAAAACCACTGGTAATGTGCAGTGGTGGTGCTGTAGAAAAAATGCTTGCTCAACATCTAAAAAAT
CTTACAATAAAAAAAAAAAAAAAAGGTACTGGACCATGTGGAAGXTTGCCCATGTTTGGGTGCACTGATGCAACCCAAGTGTTGGCTGAG
GTTCAAGAGTGTAAGAAATCATACCCACAAGCATGGATCAGAATCATTGGATTCGACAATGTGCTCAAGTGCAGTGTATCAGTTTCATTG
CCTACAAGCCAGAAGGCTACTAAGTTTCATATTAGGAACAAAATTGTCTTTAGGGACACTTTGTTTTTAAATGCTACTTAG\
Edits in Original Sequence 
GTCTTCTCCTTCACCCATTCTCTCTCTTTAAAT(5')ATGGCTGAAAATAGTGGAAAAGGGATCGGAAGAAACTCAGGAACCTCTCGTGT
TGCACTTXTAATGAAAGAATTCTCTCCTCAATGTCACGAAGATXCTATTGCTGCTCATCCGTGGCATGACCTAGAGATTGGGCCAGGTGC
ACCTTCAATTTTCAACTGTGTGGTTGAAATAGGCAAAGGCAGCAAAGTCAAGTATGAGCTTGACAAAGCAAGTGGCCTTATAAAGGTTGA
CCGAATACTGTACTCATCAGTTGTTTATCCACACAACTATGGTTTCATCCCAAGAACCCTTTGTGAAGACAGTGATCCAATGGACGTCTT
GGTACTGATGCAGGAACCTGTGTTACCAAGTACCTTTCTTCGTGCTCGTGCAATTGGATTGATGCCTATGATTGATCAGGGTGAGAAAGA
TGACAAGATAATAGCAGTGTGTGCAGATGATCCTGAGTTTCGCCACTACACAGACATCAAGGAGCTCCCTCCTCATCGTCTTGCTGAAAT
CCGGCGCTTTTTTGAAGACTATAAAAAGAATGAGAACAAGTCAGTTGCAGTTGAGGACTTTCTGCCTGCTGAAGCAGCTGTAGATGCCAT
CAAGTATTCCATGGACTTGTATGCTTCTTACATTGTGGAAAGTTTGaGGAAGTGACCTTGTTGAGGACATGTTGTTGXTCATGACTGAAA
ATCtAAGTAGAGAAGCCGGTTGAXCTTGTTGAAGATGGCTCCCTGAATTTCAtATGCGTACTTTAGTTTAATGTGGTATTATCAAATACC
ATTTGAAATGCATGTAGAACTTTCAATTTTCATGTATTCAGAAAAGATgTGGAACAGAAGCATCAAGAAAACCACTGGTAATGTGCAGTG
GTGGTGCTGTAGAAAAAATGCTTGCTCAACATCTAAAAAATCTTACAATAAAAAAAAAAAAAAAAGGTACTGGACCATGTGGAAGXTTGC
CCATGTTTGGGTGCACTGATGCAACCCAAGTGTTGGCTGAGGTTCAAGAGTGTAAGAAATCATACCCACAAGCATGGATCAGAATCATTG
GATTCGACAATGTGCgTCAAGTGCAGTGTATCAGTTTCATTGCCTACAAGCCAGAAGGCTACTAAGTTTCATATTAGGAACAAAATTGTC
TTTAGGGACACTTTGTTTTTAAATGCTACTTAG\(3')GTTTCTTTGTAGTTTTTTTCTTAATTCCAACAAACTATTTATGTNTTCTTAA
TAATTTACTATTCGGTTTATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan