ESTScan Details for Unigene SGN-U281394

Score 
240
Direction 
Forward
Predicted Peptide Sequence 
RRSLAISSIFYANXPPIPPPLAAVSAAWDRRAPLKFTGFSISYTSVNNQVSLASSSRISRRTNSVSGEASDVAFDVPTVTEETWDSLVLN
ATEPVVVEFWAPWCGPCRMFHPVISDLAKQYTGRVKCFKLNTDDSPSVASRYGIRSIPTIMIFVNGEKKDAIIGAVPKXKSNCQHR
Predicted Coding Sequence 
AGGCGATCACTCGCCATCTCTTCAATTTTTTACGCTAATXCTCCGCCCATCCCTCCGCCCCTCGCCGCCGTCTCCGCCGCATGGGACCGC
CGTGCCCCTCTGAAATTCACCGGTTTTTCTATATCATATACCTCTGTTAATAATCAAGTTTCACTTGCATCTTCTTCAAGGATTTCTCGC
CGCACAAATAGCGTATCCGGCGAAGCTTCCGATGTTGCCTTCGATGTTCCTACCGTGACAGAGGAAACATGGGATTCACTCGTTCTCAAC
GCTACTGAACCTGTGGTGGTTGAGTTTTGGGCTCCCTGGTGTGGACCATGTCGCATGTTCCATCCAGTAATCAGTGATCTTGCAAAGCAA
TACACAGGAAGGGTAAAGTGCTTCAAATTGAATACCGATGACAGCCCTTCTGTAGCATCTAGATATGGAATCCGAAGCATCCCAACAATA
ATGATCTTCGTTAACGGAGAGAAGAAAGATGCTATCATTGGTGCTGTACCCAAAXACAAGTCTAACTGCCAGCATAGATAA\
Edits in Original Sequence 
(5')AGGCGATCACTCGCCATCTCTTCAATTTTTTACGCTAATXCTCCGCCCATCCCTCCGCCCCTCGCCGCCGtTCTCCGCCGCATGGG
ACCGCCGTGCCCCTCTGAAATTCACCGGTTTTTCTATATCATATACCTCTGTTAATAATCAAGTTTCACTTGCATCTTCTTCAAGGATTT
CTCGCCGCACAAATAGCGTATCCGGCGAAGCTTCCGATGTTGCCTTCGATGTTCCTACCGTGACAGAGGAAACATGGGATTCACTCGTTC
TCAACGCTACTGAACCTGTGGTGGTTGAGTTTTGGGCTCCCTGGTGTGGACCATGTCGCATGTTCCATCCAGTAATCAGTGATCTTGCAA
AGCAATACACAGGAAGGGTAAAGTGCTTCAAATTGAATACCGATGACAGCCCTTCTGTAGCATCTAGATATGGAATCCGAAGCATCCCAA
CAATAATGATCTTCGTTAACGGAGAGAAGAAAGATGCTATCATTGGTGCTGTACCCAAAXACAAGTCTAACTGCCAGCATAGATAA\(3')
ATTCTTGTAGAAGCTGCTGAATGGTAAAGCCAAAAGCTACATTTGCTTTGTTTTGTCTTCTTTTTTCTTTCTTTTGAATGGTAAAAACA
AAGCTACACTTGGTTTTGAGCTTTAACTTAAATGAAGTCCATTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan