ESTScan Details for Unigene SGN-U281528

Score 
763
Direction 
Forward
Predicted Peptide Sequence 
MKVPTIDFCKPELKPGTIQWDSTKSQVFQALQEYGCFEAIYDKLKNETLEAMFGSSKEIFEFPLEIKMKNLKLPFNGYLGKLPTLPLYES
LCIDDLFQPEIVETFTNIFWPEGNAEFCNVVKSYSKPLVELDEMVKRMVLERLGLQNYIDQFLDLTSFQLRLTKYNAAQDEEIGNKPGLG
DHTDGTFLTIISQNQVNGLQILKKNGEWIDVDISSNSFIVLAGDXPSW
Predicted Coding Sequence 
ATGAAGGTTCCTACCATAGATTTCTGCAAGCCAGAGCTAAAGCCAGGTACTATACAATGGGATTCCACAAAATCTCAAGTTTTTCAAGCC
TTGCAAGAGTATGGTTGCTTTGAAGCAATATATGATAAGCTTAAAAATGAAACTTTAGAAGCCATGTTTGGTAGTTCAAAAGAGATCTTT
GAATTTCCATTGGAGATCAAAATGAAAAACTTGAAATTACCCTTTAATGGCTACTTAGGGAAGCTACCAACATTACCATTGTATGAGAGT
CTATGCATTGATGACTTGTTTCAACCTGAAATTGTTGAAACTTTTACTAATATCTTCTGGCCTGAGGGAAATGCTGAGTTTTGCAATGTA
GTAAAGTCCTACTCAAAGCCACTTGTGGAATTGGATGAGATGGTTAAAAGGATGGTTTTGGAGAGACTAGGACTACAAAATTACATTGAT
CAATTCTTGGATCTCACCTCTTTCCAATTGCGATTAACCAAATACAATGCAGCTCAAGATGAAGAAATTGGGAATAAACCTGGACTTGGT
GACCATACTGATGGTACCTTCTTGACCATAATATCACAAAATCAAGTAAATGGATTGCAAATTCTCAAGAAAAATGGAGAATGGATTGAT
GTTGATATTTCATCGAATTCGTTCATTGTTTTGGCCGGAGATXTCCCTTCATGGTAA\
Edits in Original Sequence 
GGATAACCAATTATTGTAATATATCTTCTATTTCCTTTTTTTTATATTGTTAACTTCTTAATTCTAATAAA(5')ATGAAGGTTCCTACC
ATAGATTTCTGCAAGCCAGAGCTAAAGCCAGGTACTATACAATGGGATTCCACAAAATCTCAAGTTTTTCAAGCCTTGCAAGAGTATGGT
TGCTTTGAAGCAATATATGATAAGCTTAAAAATGAAACTTTAGAAGCCATGTTTGGTAGTTCAAAAGAGATCTTTGAATTTCCATTGGAG
ATCAAAATGAAAAACTTGAAATTACCCTTTAATGGCTACTTAGGGAAGCTACCAACATTACCATTGTATGAGAGTCTATGCATTGATGAC
TTGTTTCAACCTGAAATTGTTGAAACTTTTACTAATATCTTCTGGCCTGAGGGAAATGCTGAGTTTTGCAATGTAGTAAAGTCCTACTCA
AAGCCACTTGTGGAATTGGATGAGATGGTTAAAAGGATGGTTTTGGAGAGACTAGGACTACAAAATTACATTGATCAATTCTTGGATCTC
ACCTCTTTCCAATTGCGATTAACCAAATACAATGCAGCTCAAGATGAAGAAATTGGGAATAAACCTGGACTTGGTGACCATACTGATGGT
ACCTTCTTGACCATAATATCACAAAATCAAGTAAATGGATTGCAAATTCTCAAGAAAAATGGAGAATGGATTGATGTTGATATTTCATCG
AATTCGTTCATTGTTTTGGCCGGAGATXTCCCTTCATGGTAA\(3')GATTAACTTTATTGTCATTATTTTTTTGTAGGGAAAAGGGGGG
GAATTATTGGCCTAGTTTCAGCTTACA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan