ESTScan Details for Unigene SGN-U281680

Score 
770
Direction 
Forward
Predicted Peptide Sequence 
KXVEELVFLIDMLFSCNMQALIHLESIQSLPKRVDLLDSLVDKFLVPSPENPNIASVDEREELSSIFIEFLDLFGDAVSIKKADDRHAKL
FLRHRSSSDSKKRQAEDYIVSEKTKLAKSAVATTNPSVVGAYPGAQNQWPAGYGVQGQTWPQATQAQTQQWNPGYAQQAAYGAYGSYGTG
YAPPQAPAASVPSSAGYGAYPSTFPAQAFPQQNYAQPAAAAAATAALTPAPQATTVPPTAYYGVTIEMAKFSAVNFFAGCSLYLPLNGQN
MLQYHEFFYMVVI
Predicted Coding Sequence 
AAAXCTGTGGAGGAATTGGTGTTTCTTATTGATATGCTCTTTTCATGTAATATGCAGGCACTAATCCATTTAGAATCCATTCAGTCACTC
CCAAAGAGAGTAGATTTGTTGGATTCATTGGTTGATAAGTTCTTAGTTCCATCTCCTGAGAACCCTAACATTGCAAGTGTTGATGAAAGA
GAGGAATTATCAAGCATTTTCATAGAGTTTCTCGATCTTTTTGGTGATGCAGTCTCAATTAAGAAGGCTGATGATCGGCATGCGAAACTC
TTCTTACGCCATAGATCTTCTTCAGATTCAAAGAAACGTCAGGCTGAAGATTATATAGTTTCTGAGAAAACAAAGCTGGCAAAGTCTGCT
GTTGCAACAACCAACCCTTCAGTGGTTGGTGCATATCCTGGAGCACAGAATCAATGGCCTGCAGGTTATGGTGTACAAGGTCAAACCTGG
CCACAGGCTACACAAGCCCAAACGCAGCAGTGGAATCCTGGTTATGCGCAACAGGCAGCATATGGTGCTTACGGCAGTTATGGAACTGGC
TATGCACCTCCTCAAGCGCCTGCAGCATCAGTGCCCTCTAGTGCTGGTTATGGTGCCTATCCTTCAACATTCCCAGCCCAGGCCTTCCCT
CAGCAGAATTATGCACAGCCAGCAGCCGCTGCCGCTGCCACTGCCGCTTTGACTCCAGCACCACAAGCTACAACTGTTCCTCCTACAGCT
TATTACGGAGTTACTATTGAAATGGCAAAGTTTTCTGCXGTCAATTTTTTTGCTGGATGTAGTTTGTATCTTCCCCTCAACGGCCAGAAT
ATGTTGCAATACCATGAGTTCTTCTACATGGTTGTAATTTGA\
Edits in Original Sequence 
(5')AAAXCTGTGGAGGAATTGGTGTTTCTTATTGATATGCTCTTTTCATGTAATATGCAGGCACTAATCCATTTAGAATCCATTCAGTC
ACTCCCAAAGAGAGTAGATTTGTTGGATTCATTGGTTGATAAGTTCTTAGTTCCATCTCCTGAGAACCCTAACATTGCAAGTGTTGATGA
AAGAGAGGAATTATCAAGCATTTTCATAGAGTTTCTCGATCTTTTTGGTGATGCAGTCTCAATTAAGAAGGCTGATGATCGGCATGCGAA
ACTCTTCTTACGCCATAGATCTTCTTCAGATTCAAAGAAACGTCAGGCTGAAGATTATATAGTTTCTGAGAAAACAAAGCTGGCAAAGTC
TGCTGTTGCAACAACCAACCCTTCAGTGGTTGGTGCATATCCTGGAGCACAGAATCAATGGCCTGCAGGTTATGGTGTACAAGGTCAAAC
CTGGCCACAGGCTACACAAGCCCAAACGCAGCAGTGGAATCCTGGTTATGCGCAACAGGCAGCATATGGTGCTTACGGCAGTTATGGAAC
TGGCTATGCACCTCCTCAAGCGCCTGCAGCATCAGTGCCCTCTAGTGCTGGTTATGGTGCCTATCCTTCAACATTCCCAGCCCAGGCCTT
CCCTCAGCAGAATTATGCACAGCCAGCAGCCGCTGCCGCTGCCACTGCCGCTTTGACTCCAGCACCACAAGCTACAACTGTTCCTCCTAC
AGCTTATTACGGcAGTTACTATTGAAATGGCAAAGTTTTCTGCXGTCAATTTTTTTGCTGGATGTAGTTTGTATCTTCCCCTCAACGGCC
AGAATATGTTGCAATACCATGAGTTCTTCTACATGGTTGTAATTTGA\(3')TTTAATGAGCAGTCGGATAGGAAATTGAGCAATCTAGT
GATGTCTTACCTTAGGCTGTTTGCTTTTCTCTAATTAATGTACCATACTTTTGGTTTTAAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan