ESTScan Details for Unigene SGN-U281722

Score 
316
Direction 
Forward
Predicted Peptide Sequence 
EMLALRKLSTLKSSRFLSSFAIQNPICSSSTIPDVPSCTNYDERINKAGREGDFTTVHHLLNKRGAMASSTPTIXFKFISTNNVSILDDL
LETIARLDNGFPRKSSYDCLIARLSKMHCISEAMRVAKVMVSKGHEANNVTFHPIVNALTKKEEFEEAWQVVAVMKSCGISPDLTTYNFL
LTGYCFAGNVASAAGVLAKIEEEELGADTRTYDALVLGACRAGKLDAALAVVRRMLDDG
Predicted Coding Sequence 
XTAGAAATGCTAGCACTTCGCAAGCTCTCGACCCTAAAATCATCAAGATTTCTCTCTTCTTTCGCTATTCAAAATCCTATCTGCAGCTCC
TCAACGATTCCAGACGTTCCCAGTTGCACCAATTACGATGAACGCATCAACAAAGCTGGCCGTGAAGGAGATTTCACCACTGTCCACCAC
CTTCTTAACAAGCGCGGCGCGATGGCTTCTTCAACACCAACAATACXGTTCAAGTTCATTTCCACTAATAATGTGTCCATACTCGATGAT
CTATTGGAAACTATAGCTCGGTTAGATAATGGTTTCCCGAGAAAGAGCTCCTACGACTGTCTCATTGCGCGTCTCTCGAAGATGCACTGC
ATTTCGGAGGCTATGCGTGTTGCCAAAGTTATGGTGAGCAAAGGTCACGAAGCAAACAATGTCACGTTTCATCCCATAGTTAATGCTCTG
ACGAAGAAGGAGGAATTCGAAGAAGCCTGGCAAGTAGTGGCGGTGATGAAATCCTGCGGAATTTCTCCTGATTTGACGACGTATAATTTT
CTGCTGACTGGTTATTGTTTTGCTGGAAATGTGGCATCAGCTGCTGGTGTTCTAGCAAAGATAGAGGAGGAGGAGCTGGGGGCGGATACG
AGGACTTACGACGCCCTGGTTTTAGGCGCCTGTAGAGCAGGGAAGTTGGATGCTGCTTTGGCAGTGGTGAGGAGGATGCTAGATGATGGG
\
Edits in Original Sequence 
(5')XTAGAAATGCTAGCACTTCGCAAGCTCTCGACCCTAAAATCATCAAGATTTCTCTCTTCTTTCGCTATTCAAAATCCTATCTGCAG
CTCCTCAACGATTCCAGACGTTCCCAGTTGCACCAATTACGATGAACGCATCAACAAAGCTGGCCGTGAAGGAGATTTCACCACTGTCCA
CCACCTTCTTAACAAGCGCGcGCGCGATGGCTTCTTCAACACCAACAATACXGTTCAAGTTCATTTCCACTAATAATGTGTCCATACTCG
ATGATCTATTGGAAACTATAGCTCGGTTAGATAATGGTTTCCCGAGAAAGAGCTCCTACGACTGTCTCATTGCGCGTCTCTCGAAGATGC
ACTGCATTTCGGAGGCTATGCGTGTTGCCAAAGTTATGGTGAGCAAAGGTCACGAAGCAAACAATGTCACGTTTCATCCCATAGTTAATG
CTCTGACGAAGAAGGAGGAATTCGAAGAAGCCTGGCAAGTAGTGGCGGTGATGAAATCCTGCGGAATTTCTCCTGATTTGACGACGTATA
ATTTTCTGCTGACTGGTTATTGTTTTGCTGGAAATGTGGCATCAGCTGCTGGTGTTCTAGCAAAGATAGAGGAGGAGGAGCTGGGGGCGG
ATACGAGGACTTACGACGCCCTGGTTTTAGGCGCCTGTAGAGCAGGGAAGTTGGATGCTGCTTTGGCAGTGGTGAGGAGGATGCTAGATG
ATGGG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan