ESTScan Details for Unigene SGN-U281736

Score 
714
Direction 
Forward
Predicted Peptide Sequence 
MAEAFVKVLIDNRTSFLKGELVLLFGFQNEFQRLSSIFSTIQAVLEDAQEKQLNDKPTTIAEKIRERQVALAFESNFWIFLESTRSLKSI
KFDKFVLCFDQSPLIKLLIQALQWDLVAGPSSCTTPNMSFVFRGARADIEPGFPGLIPERRAVRVHAGRPVNTNSLAFLVTXALAVHDSE
FSSNVTELSAVVGAWCLLHGNNPKDVCNVQQLQAQAQAHAVAASGLLGPTELRLHMPPSIALATRGRLRGLRLQLALLDREFDDLDYETL
RALDSDDAPTTPIMT
Predicted Coding Sequence 
ATGGCTGAAGCTTTCGTCAAAGTTCTGATAGACAATCGTACTTCTTTCCTCAAAGGGGAACTTGTATTGCTTTTCGGTTTTCAAAATGAA
TTCCAAAGGCTTTCAAGCATCTTCTCTACAATTCAAGCCGTCCTTGAAGATGCTCAGGAGAAGCAACTCAACGACAAGCCAACGACAATT
GCAGAAAAGATTAGAGAGAGACAAGTTGCTTTGGCGTTCGAGTCCAATTTCTGGATCTTTCTAGAGTCGACTCGTTCGCTCAAATCGATC
AAATTTGATAAATTTGTTCTGTGTTTCGATCAATCGCCATTAATCAAGCTTTTAATTCAAGCTCTTCAGTGGGATTTGGTTGCTGGACCT
TCTTCTTGTACAACTCCAAACATGAGTTTTGTTTTCCGAGGTGCTAGAGCAGATATAGAACCTGGTTTTCCAGGATTGATCCCTGAGCGC
CGTGCAGTGCGAGTCCATGCTGGCCGTCCAGTTAATACTAACTCACTAGCTTTTCTTGTCACAGXTGCTCTTGCTGTTCATGATTCTGAA
TTCTCATCAAATGTCACCGAACTTTCTGCTGTGGTTGGTGCTTGGTGTCTTCTTCATGGCAACAACCCTAAGGATGTATGCAACGTGCAG
CAGCTTCAAGCCCAGGCACAAGCTCACGCTGTTGCTGCAAGTGGCCTTCTTGGTCCTACAGAGTTGCGGCTGCATATGCCCCCATCAATA
GCACTTGCAACCAGAGGACGGTTGCGAGGCCTCAGACTACAGCTTGCACTTCTTGACAGGGAGTTTGATGACTTAGATTATGAAACGTTG
AGGGCACTGGATTCTGATGATGCTCCTACAACCCCCATCATGACT\
Edits in Original Sequence 
AAAAAAACAAACTGTGATTCTTACTTTTATTGACAAACCAAAACCAGCCCACAGGAAGCTTTGTATTTCATTCCAACAACCACTATATAT
TAAATTTAGACATTCATTGTTTACAATTCTACACTCACTCCACATATCTGATATTCGTAATAGTGAATTCAACAT
(5')ATGGCTGAAGC
TTTCGTCAAAGTTCTGATAGACAATCGTACTTCTTTCCTCAAAGGGGAACTTGTATTGCTTTTCGGTTTTCAAAATGAATTCCAAAGGCT
TTCAAGCATCTTCTCTACAATTCAAGCCGTCCTTGAAGATGCTCAGGAGAAGCAACTCAACGACAAGCCAACGACAATTGCAcGAAAAGA
TTAGAGAGAGACAAGTTGCTTTGGCGTTCGAGTCCAATTTCTGGATCTTTCTAGAGTCGACTCGTTCGCTCAtAATCGATCAAATTTGAT
AAATTTGTTCTGTGTTTCGATCAATCGCCATTAATCAAGCTTTTAATTCAAGCTCTTCAGTGGGATTTGGTTGCTGGACCTTCTaTCTTG
TACAACTCCAAACATGAGTTTTGTTTTCCGAGGTGCTAGAGCAGATATAGAACCTGGTTTTCCAGGATTGATCCCTGAGCGCCGTGCAGT
GCGAGTCCATGCTGGCCGTCCAGTTAATACTAACTCACTAGCTTTTCTTGTCACAGXTGCTCTTGCTGTTCATGATTCTGAATTCTCATC
AAATGTCACCGAACTTTCTGCTGTGGTTGGTGCTTGGTGTCTTCTTCATGGCAACAACCCTAAGGATGTATGCAACGTGtCAGCAGCTTC
AAGCCCAGGCACAAGCTCACGCTGTTGCTGCAAGTGGCCTTCTTGGTCCTACAGAGTTGCGGCTGCATATGCCCCCATCAATAGCACTTG
CAACCAGAGGACGGTTGCGAGGCCTCAGACTACAGCTTGCACTTCTTGACAGGGAGTTTGATGACTTAGATTATGAAACGTTGAGGGCAC
TGGATTCTGATGATGCTCCTACAACCCCCATCATGACT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan