ESTScan Details for Unigene SGN-U281741

Score 
737
Direction 
Forward
Predicted Peptide Sequence 
MAATYGXAISQDILSDVLIIYCFIAVWFVGGLTIFHFYLISTNQTTYENFRYRYDKKENPYNRGTIENIREVFFSKIPPSLNNFRAVFKE
NDIVMVEPATSNFVGNINSSKEKIDIEMGTMFPEDSGLSLPEILRNLEYEEIDDTLKSREWTRDAYSDSGEHMRSITSLKETIDIEVGDN
FAEDKGTAQAEISQNMNGDSIKKNFKNKDEGGRTDYEPFWFSFEQEKESVKSSTLGSASNVEDNSEEVSSSALYMTPINDRSPKHTHYKE
LSLESFVFTLWQHGKLDQDSRLFKLSRTRSATYGKIVFEIMQGLA
Predicted Coding Sequence 
ATGGCGGCAACTTATGGAGXAGCTATTTCACAAGATATCTTGTCGGATGTTCTCATTATATACTGCTTCATTGCTGTTTGGTTTGTTGGC
GGCCTTACTATTTTCCATTTTTACCTGATTAGCACTAACCAGACTACTTACGAGAACTTTAGGTATCGATATGATAAGAAGGAGAATCCC
TATAATAGGGGGACAATTGAAAATATCAGAGAAGTTTTCTTTTCCAAGATCCCACCTTCCTTAAATAATTTTCGAGCAGTTTTTAAAGAA
AATGACATTGTAATGGTTGAGCCAGCAACTTCCAACTTTGTGGGAAATATCAATAGCTCAAAAGAGAAGATAGATATTGAGATGGGAACA
ATGTTTCCAGAGGATAGTGGACTTTCACTTCCTGAAATTTTGCGGAATTTGGAATATGAGGAGATAGATGATACTTTAAAAAGCAGGGAA
TGGACCAGAGATGCTTATTCTGATTCTGGTGAGCATATGCGGAGCATCACCAGCTTAAAGGAGACAATTGATATTGAGGTGGGAGATAAC
TTTGCAGAAGATAAAGGAACTGCACAGGCAGAAATTTCGCAGAATATGAATGGCGATAGCATAAAGAAAAATTTCAAAAACAAGGATGAA
GGTGGGAGAACTGATTATGAACCTTTTTGGTTTTCATTTGAACAAGAAAAAGAAAGTGTAAAGAGCTCCACTCTAGGAAGTGCATCTAAT
GTAGAAGATAACTCGGAAGAAGTAAGTAGCTCGGCTCTGTATATGACACCAATAAATGATCGTAGCCCAAAGCATACACATTATAAGGAA
CTCTCCCTTGAGTCTTTTGTGTTTACCTTGTGGCAGCATGGGAAGCTTGACCAAGATTCACGGCTTTTCAAATTATCACGTACAAGATCA
GCAACATATGGAAAAATTGTGTTTGAAATAATGCAGGGTCTTGCTTGA\
Edits in Original Sequence 
ATTTGTTCATATCTACATCAACTATATTATGCATATATGTCTTTGTCATATCCTTGGTCAATATCCTTCATC(5')ATGGCGGCAACTTA
TGGAGXAGCTATTTCACAAGATATCTTGTCGGATGTTCTCATTATATACTGCTTCATTGCTGTTTGGTTTGTTGGCGGCCTTACTATTTT
CCATTTTTACCTGATTAGCACTAACCAGACTACTTACGAGAACTTTAGGTATCGATATGATAAGAAGGAGAATCCCTATAATAGGGGGAC
AATTGAAAATATCAGAGAAGTTTTCTTTTCCAAGATCCCACCTTCCTTAAATAATTTTCGAGCAGTTTTTAAAGAAAATGACATTGTAAT
GGTTGAGCCAGCAACTTCCAACTTTGTGGGAAATATCAATAGCTCAAAAGAGAAGATAGATATTGAGATGGGAACAATGTTTCCAGAGGA
TAGTGGACTTTCACTTCCTGAAATTTTGCGGAATTTGGAATATGAGGAGATAGATGATACTTTAAAAAGCAGGGAATGGACCAGAGATGC
TTATTCTGATTCTGGTGAGCATATGCGGAGCATCACCAGCTTAAAGGAGACAATTGATATTGAGGTGGGAGATAACTTTGCAGAAGATAA
AGGAACTGCACAGGCAGAAATTTCGCAGAATATGAATGGCGATAGCATAAAGAAAAATTTCAAAAACAAGGATGAAGGTGGGAGAACTGA
TTATGAACCTTTTTGGTTTTCATTTGAACAAGAAAAAGAAAGTGTAAAGAGCTCCACTCTAGGAAGTGCATCTAATGTAGAAGATAACTC
GGAAGAAGTAAGTAGCTCGGCTCTGTATATGACACCAATAAATGATCGTAGCCCAAAGCATACACATTATAAGGAACTCTCCCTTGAGTC
TTTTGTGTTTACCTTGTGGCAGCATGGGAAcGCTTGACCAAGATTCACGGCTTTTCAAATTATCACGTACAAGATCAGCAACATATGGAA
AAATTGTGTTTGAAATAATGCAGGGTCTTGCTTGA\(3')GATGAGAGCAGATCCTGTTGTTCAAAATTGTAGATAGATTGATGAGTAGC
TCCTTTCTTTGTTCATCCTTTTGTCCAATTCCATCCAAGTCTTTTTTTCATTTTCTTACAAAGTCAGTGTGCATAGTTTGTGTATCATGT
GAAGCTTTTGGGTGATAGAAAATTTATTGGAGAAACAAATAGATAGATTGTTTTCGGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan