ESTScan Details for Unigene SGN-U281853

Score 
492
Direction 
Forward
Predicted Peptide Sequence 
WVLKNEHSYDRRSELLAFDNTQAGVKGLVDAGVKKVPKIFYTPQDAYSNDPEKNQFSIPVIDLDGISKDPIQHKEIIEKIRDASEVWGFL
QVVNHGIPQSVLEEMLNGVRRFYEQDTEVKKQWYTRDTSKKVVYNSNFDLFKSASANWRDTTYCNMAPLPPSADELPDACRDILIEYTEQ
VKKLGRSLFDYSLKRLGLTELSDDIGLSEGLAXLYHWYPACPX
Predicted Coding Sequence 
TGGGTTCTCAAAAATGAACATAGCTATGACAGAAGAAGTGAATTACTAGCTTTTGATAACACACAAGCTGGTGTTAAAGGACTAGTTGAT
GCAGGAGTTAAAAAAGTACCAAAAATTTTCTACACACCACAAGATGCATATTCAAATGATCCTGAAAAAAACCAATTCAGTATTCCTGTT
ATAGACTTAGATGGCATAAGTAAAGATCCAATTCAACATAAGGAAATCATCGAAAAAATACGCGATGCATCGGAAGTGTGGGGTTTTCTT
CAAGTGGTAAACCATGGAATTCCTCAAAGTGTTTTGGAAGAAATGTTGAATGGTGTTAGGAGATTCTATGAGCAAGATACTGAGGTGAAG
AAACAATGGTACACGCGGGATACCTCAAAAAAAGTTGTGTATAATAGCAATTTTGATCTGTTTAAGTCTGCATCAGCTAACTGGAGGGAT
ACTACTTATTGTAATATGGCTCCACTCCCTCCTTCTGCTGATGAATTGCCAGACGCTTGCAGGGATATTCTGATTGAGTACACGGAACAA
GTGAAGAAGTTAGGTCGTTCTTTGTTTGATTACTCTCTGAAGCGCTTGGGTCTCACCGAGCTATCTGATGACATTGGGTTGTCAGAGGGG
CTTGCTGNTTTGTATCATTGGTATCCAGCATGCCCTGXX\
Edits in Original Sequence 
CAAGCTTTAGTTTCTCTAGCAGAAAAAAAAA(5')TGGGTTCTCAAAAATGAACATAGCTATGACAGAAGAAGTGAATTACTAGCTTTTG
ATAACACACAAGCTGGTGTTAAAGGACTAGTTGATGCAGGAGTTAAAAAAGTACCAAAAATTTTCTACACACCACAAGATGCATATTCAA
ATGATCCTGAAAAAAACCAATTCAGTATTCCTGTTATAGACTTAGATGGCATAAGTAAAGATCCAATTCAACATAAGGAAATCATCGAAA
AAATACGCGATGCATCGGAAGTGTGGGGTTTTCTTCAAGTGGTAAACCATGGAATTCCTCAAAGTGTTTTGGAAGAAATGTTGAATGGTG
TTAGGAGATTCTATGAGCAAGATACTGAGGTGAAGAAACAATGGTACACGCGGGATACCTCAAAAAAAGTTGTGTATAATAGCAATTTTG
ATCTGTTTAAGTCTGCATCAGCTAACTGGAGGGATACTACTTATTGTAATATGGCTCCACTCCCTCCTTCTGCTGATGAATTGCCAGACG
CTTGCAGGGATATTCTGATTGAGTACACGGAACAAGTGAAGAAGTTAGGTCGTTCTTTGTTTGATTACTCTCTGAAGCGCTTGGGTCTCA
CCGAGCTATCTGaATGACATTGGGTTGTCAGAGGGGCTTGCTGNTTTGTATCATTGGTATCCAGCATGCCCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan