ESTScan Details for Unigene SGN-U281874

Score 
247
Direction 
Forward
Predicted Peptide Sequence 
ERERTSGXAEVFDQELLRYKNIEEELVSMLHVAMACVVPLPEKRPTMVEVVKLIEEIRVEQSPLGEDYDESRNSLSPSLATTEDGLPGY
Predicted Coding Sequence 
GAGAGAGAGAGAACTAGTGGAXCTGCTGAAGTGTTTGATCAAGAACTGTTGAGGTACAAAAACATTGAGGAGGAATTGGTGTCAATGCTA
CATGTAGCCATGGCATGTGTAGTGCCACTACCCGAAAAAAGGCCTACTATGGTTGAAGTTGTTAAGTTGATTGAGGAGATTAGAGTTGAA
CAATCTCCATTAGGTGAAGATTATGACGAATCGCGCAATTCTCTTTCCCCCTCCCTTGCCACCACTGAAGATGGACTCCCCGGTTACTAA
\
Edits in Original Sequence 
(5')GAGAGAGAGAGAACTAGTGGAXCTGCTGAAGTGTTTGATCAAGAACTGTTGAGGTACAAAAACATTGAGGAGGAATTGGTGTCAAT
GCTACATGTAGCCATGGCATGTGTAGTGCCACTACCCGAAAAAAGGCCTACTATGGTTGAAGTTGTTAAGTTGATTGAGGAGATTAGAGT
TGAACAATCTCCATTAGGTGAAGATTATGACGAATCGCGCAATTCTCTTTCCCCCTCCCTTGCCACCACTGAAGATGGACTCCCCGGTTA
CTAA\(3')TTTTCGATCATCGTGGCATCGATGTTTCATAGTCCTAGTAGTATATGTTCAAATTTGCAGCATCTTACTGCAAATTGGGAA
GTTCAAAAGCTATGGACTTATGTTTAGTAGTTATTTGATTGCTTTGTGTTATTCCAAATTACTGCACTTTTGGAAAATCTGATGATCCAA
CAAGCATATAAGAAGTGCAGCAATCAGTCCATTATGTATTTTTTTTAATGTAATGTAATGTAATGTTAATTCTTTGTATTTAATTCATTT
TCAAGATTTGTGTTCTAAGGCAAAACCTCACTCTACTAGCTCCTTGTTGCTTGACTTTCGAAAAGTGAAACGTGACAAGTNAAAGTAAAT
G

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan