Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U281960

Score 
658
Direction 
Forward
Predicted Peptide Sequence 
MDFLRITSLIFICGVLLNFPAIVTAGDIVHDDDLAPKKPGCENDFVLVKVQTWINGEEDAEFVGVGARFGTTIVSKEKNAQQTPLTLSDP
RDCCKPPRKKLSGEVVMVDRGHCKFTTKANNAEAAGASAILIVNNEKELYKMVCDPGETDLDIHIPAVMLPQDAGITLNKIAFX
Predicted Coding Sequence 
ATGGATTTTCTGAGAATTACTTCTCTAATTTTCATCTGTGGAGTTCTACTGAACTTTCCTGCTATAGTTACAGCTGGTGATATTGTTCAT
GATGATGACTTAGCTCCCAAGAAGCCTGGTTGTGAGAATGATTTTGTGCTGGTGAAAGTTCAAACTTGGATTAATGGGGAAGAGGATGCA
GAATTTGTTGGTGTTGGTGCTAGATTTGGCACTACTATTGTGTCAAAGGAGAAAAATGCACAACAAACTCCGCTTACTCTTTCTGACCCT
CGGGATTGTTGCAAGCCTCCAAGGAAAAAGCTTTCTGGAGAAGTCGTCATGGTAGATCGCGGCCATTGCAAATTCACAACGAAGGCTAAT
AATGCTGAAGCAGCAGGGGCTTCGGCAATCCTGATAGTAAATAATGAAAAAGAACTCTACAAGATGGTTTGTGATCCTGGAGAAACTGAC
CTAGATATACACATACCTGCTGTTATGCTACCTCAGGATGCTGGAATAACGCTTAATAAAATTGCTTTTAXX\
Edits in Original Sequence 
GTGGATCCCCGGGCTGACGAATTCGGTAAGAGGAAAAACAGTAGATCCAAAGTCCACTCATCAAACTCATAATTTTACCCTTTGAATTCA
CCTTTTGTATGATTGAGAAGTAAATAGTAGTTCCCTTTTTCTTCTCTGATTCTTCATATTTTCAAGAATTGTGTGTTTTTCTGTAAATAC
ATTTGTATGGTGATGAGCTAGCTGTGAACCCATCAAGAAAAAGGGGAATTTTTTTATTGAAATTAAGAGAATCCCC
(5')ATGGATTTTC
TGAGAATTACTTCTCTAATTTTCATCTGTGGAGTTCTACTGAACTTTCCTGCTATAGTTACAGCTGGTGATATTGTTCATGATGATGACT
TAGCTCCCAAGAAGCCTGGTTGTGAGAATGATTTTGTGCTGGTGAAAGTTCAAACTTGGATTAATGGGGAAGAGGATGCAGAATTTGTTG
GTGTTGGTGCTAGATTTGGCACTACTATTGTGTCAAAGGAGAAAAATGCACAACAAACTCCGCTTACTCTTTCTGACCCTCGGGATTGTT
GCAAGCCTCCAAGGAAAAAGCTTTCTGGAGAAGTCGTCATGGTAGATCGCGGCCATTGCAAATTCACAACGAAGGCTAATAATGCTGAAG
CAGCAGGGGCTTCGGCAATCCTGATAGTAAATAATGAAAAAGAACTCTACAAGATGGTTTGTGATCCTGGAGAAACTGACCTAGATATAC
ACATACCTGCTGTTATGCTACCTCAGGATGCTGGAATAACGCTTAATAAAATTGCTTTTAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan