ESTScan Details for Unigene SGN-U281966

Score 
239
Direction 
Reverse
Predicted Peptide Sequence 
FQVDWGIKYGAFGPDTKGLCLIVSTGFFPKVQQQSDRLIEILQLDXNNIPNGIGTQSSNLNNIQKTQPTSSAMPETFWTGCPFCNIRYQY
YRSFVNRALRCQKCSKPFIAYDLGSQGAPPGHKWSQPGSRMCPLSQTRANLISRKRLSTREPQEWQPELGLHLPKWDLNRVPAVKQWVHN
QRYGEKRLLSIX
Predicted Coding Sequence 
TTTCAAGTTGATTGGGGAATCAAATATGGTGCTTTCGGACCCGACACAAAAGGACTTTGTTTGATAGTAAGTACAGGTTTTTTTCCAAAG
GTGCAGCAGCAAAGCGACAGGTTAATCGAAATCCTTCAGCTAGACAAXAATAATATTCCAAATGGTATTGGTACTCAGTCCAGTAATCTG
AATAATATTCAGAAAACACAACCAACTTCATCAGCAATGCCTGAAACATTCTGGACGGGATGTCCTTTTTGCAATATTAGGTACCAGTAC
TACAGGAGTTTTGTGAACAGAGCTTTACGCTGCCAAAAATGCTCAAAGCCTTTCATTGCATATGATTTAGGTTCTCAAGGTGCTCCTCCT
GGACATAAATGGAGTCAACCTGGCAGCAGGATGTGCCCCTTAAGTCAAACACGAGCCAACCTTATCAGCAGAAAGAGGCTTTCAACCAGG
GAACCTCAAGAATGGCAGCCGGAGCTGGGTTTACACCTGCCCAAATGGGATCTCAACAGGGTCCCAGCAGTAAAACAATGGGTTCACAAC
CAGAGGTACGGAGAGAAAAGACTGCTCAGTATTTXX\
Edits in Original Sequence 
(5')TTTCAAGTTGATTGGGGAATCAAATATGGTGCTTTCGGACCCGACACAAAAGGACTTTGTTTGATAGTAAGTACAGGTTTTTTTCC
AAAGGTGCAGCAGCAAAGCGACAGGTTAATCGAAATCCTTCAGCTAGACAAXAATAATATTCCAAATGGTATTGGTACTCAGTCCAGTAA
TCTGAATAATATTCAGAAAACACAACCAACTTCATCAGCAATGCCTGAAACATTCTGGACGGGATGTCCTTTTTGCAATATTAGGTACCA
GTACTACAGGAGTTTTGTGAACAGAGCTTTACGCTGCCAAAAATGCTCAAAGCCTTTCATTGCATATGATTTAGGTTCTCAAGGTGCTCC
TCCTGGACATAAATGGAGTCAACCTGGCAGtCAGGATGTGCCCCTTAAGTCAAACACGAGCCAACCTTATCAGCAGAAAGAGGCTTTCAA
CCAGGGAACCTCAAGAATGGCAGCCGGAGCTGGGTTTACACCTGCCCAAATGGGATCTCAACAGGGTCCCAGCAGTAAAACAATGGGTTC
ACAACCAGAGGTACGGAGAGAAAAGACTGCTCAGTATTTXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan