ESTScan Details for Unigene SGN-U282039

Score 
193
Direction 
Forward
Predicted Peptide Sequence 
TALAFWHKFECLMCSAXAKITTSIKVDIYRVEALTEEAKGNMKRLYKSTDDEFMEFHKREIGVSQPRNFTRRISASEVTVKRLDLYGKLN
GHEGCVNTIDFNATGDVLVSGSDDRRXNTMGLGNKEIKIVLLIRPHGQHIPGQVHALPDDRKVVTAAADGQVRLGLLLENGHIETKRLGK
HQGXVYIILQWNQGAPTYCIAAVKMVFVQHYDLEAIVPXRYYVAHLSRKTISNL
Predicted Coding Sequence 
ACCGCACTTGCTTTTTGGCACAAATTTGAGTGTTTAATGTGTTCCGCAGXGGCGAAGATTACAACCTCCATTAAAGTGGATATATACAGA
GTTGAAGCACTTACXGAGGAAGCTAAAGGTAACATGAAGAGGCTGTACAAGTCTACTGACGATGAATTCATGGAGTTCCATAAGAGAGAA
ATTGGGGTTTCTCAACCCAGAAACTTCACTCGTCGAATCTCCGCTTCTGAGGTTACAGTGAAGCGGCTGGATTTGTATGGGAAGTTAAAT
GGTCATGAGGGTTGTGTTAACACAATTGACTTCAATGCCACTGGCGATGTTCTTGTCTCAGGTTCTGATGACAGACGAGXTAATACTATG
GGACTGGGCAACAAGGAAATCAAAATTGTCTTACTCATCAGGCCACATGGACAACATATTCCAGGCCAGGTTCATGCCCTTCCTGATGAT
CGGAAAGTAGTAACTGCTGCTGCTGATGGCCAGGTCAGGCTTGGTCTATTGCTGGAGAATGGCCACATAGAAACTAAAAGGCTTGGTAAG
CATCAAGGGXTCGTGTACATAATCTTGCAGTGGAACCAGGGAGCCCCTACATATTGTATAGCTGCAGTGAAGATGGTTTTTGTTCAACAT
TATGACCTGGAAGCAATTGTGCCACANAGATATTATGTTGCTCATCTTTCACGGAAAACAATAAGCAATCTX\
Edits in Original Sequence 
(5')ACCGCACTTaGCTTTTTGGCACAAATTTGAGTGTTTAATGTGTTCCGCAGXGGCGAAGATTACAACCTCCATTAAAGTGGATATAT
ACAGAGTTGAAGCACTTACXGAGGAAGCTAAAGGTAACATGAAGAGGCTGTACAAGTCTACTGACGATGAATTCATGGAGTTCCATAAGA
GAGAAATTGGGGTTTCTCAACCCAGAAACTTCACTCGTCGAATCTCCGCTTCTGAGGTTACAGTGAAGCGGCTGGATTTGTATGGGAAGT
TAAATGGTCATGAGGGTTGTGTTAACACAATTGACTTCAATGCCACTGGCGATGTTCTTGTCTCAGGTTCTGATGACAGACGAGXTAATA
CTATGGGACTGGGCAACAAGGAAATCAAAATTGTCTTACTCATCAGGCCACATGGACAACATATTCCAGGCCAGGTTCATGCCCTTCaCT
GATGATCGGAAAGTAGTAACTGCTGCTGCTGATGGCCAGGTCAGGCTTGGTCTATTGCTGGAGAATGGCCACATAGAAACTAAAAGGCTT
GGTAAGCATCAAGGGXTCGTGTACATAATCTTGCAGTGGAACCAGGGAGCCCCTACATATTGTATAGCTGCAGTGAAGATGGTTTTTGTT
CAACATTATGACCTGcGAAGCAATTGTGCCACANAGATATTATGTTGCTCATCTTTCACGGAAAACAATAAGCAATCTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan