Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U282071

Score 
330
Direction 
Forward
Predicted Peptide Sequence 
KTRKLRNPELNXSVVQSKRVLFAFDSSDSSATVGQYSFLETPHTYPHNSQKKIVKKEKLLRLLLKAAAVPELTXVIVKSRRIFHSGELIL
ALLKTFASHVSYTYLSVSGLDGHFLIGATPEKPNNQFQLLMEQADNRSNNEHVIDITTSNDASSSSNPHDRPVNNVLHVQAEHPPSTSTT
VPVSQHAFSSANRSNLRNSSFAEEEMGAAIGXPLNSVLWISIELVLTMSQIIAAIAVLAISRDEHPRAPLSQWIVGYASGCVAILPLLYW
RFX
Predicted Coding Sequence 
AAAACGCGTAAACTGAGAAATCCAGAGCTCAACXTGAGTGTTGTTCAATCCAAAAGAGTTTTGTTTGCTTTCGATTCATCTGATTCTTCA
GCTACAGTGGGTCAGTACTCTTTCTTGGAAACCCCACACACCTACCCGCACAATTCACAGAAAAAAATTGTTAAAAAAGAAAAACTGCTT
AGACTTCTCCTTAAAGCTGCTGCAGTCCCTGAATTAACTGXGGTGATTGTGAAGAGCAGAAGAATTTTTCATTCTGGTGAACTCATACTT
GCACTGCTTAAGACTTTTGCATCCCATGTTTCCTATACTTATCTCTCAGTCAGTGGACTTGATGGCCATTTCCTCATTGGGGCTACACCG
GAAAAGCCAAACAACCAGTTTCAATTATTAATGGAGCAAGCAGATAACCGTAGCAACAATGAGCATGTTATTGACATAACTACTAGCAAC
GATGCATCCTCATCTAGCAACCCCCATGATAGACCAGTTAATAATGTGCTTCATGTCCAAGCTGAACATCCCCCATCAACAAGCACAACA
GTGCCCGTCTCCCAACATGCATTTTCTTCTGCTAATAGATCCAACTTGAGGAACTCATCATTTGCTGAAGAGGAAATGGGCGCCGCCATC
GGAGXTCCTCTGAATTCCGTGCTCTGGATATCCATTGAACTAGTCTTGACAATGAGCCAAATAATTGCAGCAATCGCGGTGTTGGCCATA
TCAAGGGATGAGCACCCACGAGCTCCTCTATCCCAATGGATAGTTGGTTATGCATCTGGGTGTGTAGCAATCCTACCTCTTCTCTACTGG
CGTTTTCXX\
Edits in Original Sequence 
(5')AAAACGCGTAAACTGAGAAATCCAGAGCTCAACXTGAGTGTTGTTCAATCCAAAAGAGTTTTGTTTGCTTTCGATTCATCTGATTC
TTCAGCTACAGTGGGTCAGTACTCTTTCTTGaGAAACCCCACACACCTACCCGCACAATTCACAGAAAAAAATTGTTAAAAAAGAAAAAC
TGCTTAGACTTCTCCTaTAAAGCTGCTGCAGTCCCTGAATTAACTGXGGTGATTGTGAAGAGCAGAAGAATTTTTCATTCTGGTGAACTC
ATACTTGCACTGCTTAAGACTTTTGCATCCCATGTTTCCTATACTTATCTCTCAGTCAGTGGACTTaGATGGCCATTTCCTCATTGGGGC
TACACCGGAAAAGCCAAACtAACCAGTTTCAATTATTAATGGAGCAAGCAGATAACCGTAGCAACAATGAGCATGTTATTGACATAACTA
CTAGCAACGATGCATCCTCATCTAGCAACCCCCATGATAGACCAGTTAATAATGTGCTTCATGTCCAAGCTGAACATCCCCCATCAACAA
GCACAACAGTGCCCGTCTCCCAACATGCATTTTCTTCTGCTAATAGATCCAACTTGAGGAACTCATCATTTGCTcGAAGAGGAAATGGGC
GCCGCCATCGGAGXTCCTCTGAATTCCGTGCTCTGGATATCCATTGAACTAGTCTTGACAATGAGCCAAATAATTGCAGCAATCGCGGTG
TTGGCCATATCAAGGGATGAGCACCCACGAGCTCCTCTATCCCAATGGATAGTTGGTTATGCATCTGGGTGTGTAGCAATCCTACCTCTT
CTCTACTGGCGTTTTCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan