ESTScan Details for Unigene SGN-U282091

Score 
152
Direction 
Forward
Predicted Peptide Sequence 
AVTRAKPLGXTNFLSLDLSSSFSHFNNWNSKISEAXFVLQFDLTRISTATSITDSGSSFGEFSYSSLKMPLRLEIKRKLAQRSERVKCVD
LHPTEPWILTSLYSGAVCIWNYQTQTMVKSFEATELPVRSAKFIARKQWVVAGADDMYIRVYNYNTMDKVKVFEAHTDYIRCVAVHPSLP
YVLSSSDDMLIKLWDWEKGWLCTQIFEGHSHYVM
Predicted Coding Sequence 
XXCGCTGTTACACGAGCTAAACCTCTAGGAGXTACTAATTTTCTCTCTCTTGATCTCTCTTCGTCCTTCTCTCACTTCAACAATTGGAAT
TCGAAGATCTCTGAAGCTAAXTTTGTGCTTCAATTTGATCTCACTCGAATCTCTACCGCTACTTCAATCACTGATTCXGGTTCCTCTTTC
GGAGAGTTCTCATATTCATCGCTGAAAATGCCTCTGAGATTGGAGATTAAGAGGAAACTTGCTCAAAGATCAGAAAGGGTAAAGTGTGTG
GATCTACATCCTACGGAGCCATGGATATTGACAAGTTTGTATTCGGGGGCTGTTTGCATCTGGAACTACCAGACCCAGACAATGGTCAAA
TCTTTCGAGGCGACTGAATTACCAGTTAGGTCAGCGAAGTTTATAGCACGCAAGCAATGGGTTGTTGCCGGTGCTGATGATATGTACATT
CGTGTATACAATTACAATACCATGGACAAGGTCAAAGTATTCGAAGCGCACACTGATTATATTAGGTGTGTGGCTGTCCATCCTTCTCTA
CCATATGTGCTGTCATCTTCTGATGACATGCTTATAAAGCTATGGGACTGGGAGAAAGGATGGCTATGCACTCAAATCTTTGAGGGGCAT
TCCCATTATGTGATG\
Edits in Original Sequence 
(5')XXCGCTGTTACACGAGCTAAACCTCTAGGAGXTACTAATTTTCTCTCTCTTGATCTCTCTTCGTCCTTCTCTCACTTCAACAATTG
GAATTCGAAGATCTCTGAAGCTAAXTTTGTGCTTCAATTTGATCTCACTCGAATCTCTACCGCTACTTCAATCACTGATTCXGGTTCCTC
TTTCGGAGAGTTCTCATATTCATCGCTGAAAATGCCTCTGAGATTGGAGATTAAGAGGAAACTTGCTCAAAGATCAGAAAGGGTAAAGTG
TGTGGATCTACATCCTACGGAGCCATGGATATTGACAAGTTTGTATTCGGGGGCTGTTTGCATCTGGAACTACCAGACCCAGACAATGGT
CAAATCTTTCGAGGCGACTGAATTACCAGTTAGGTCAGCGAAGTTTATAGCACGCAAGCAATGGGTTGTTGCCGGTGCTGATGATATGTA
CATTCGTGTATACAATTACAATACCATGGACAAGGTCAAAGTATTCGAAGCGCACACTGATTATATTAGGTGTGTGGCTGTCCATCCTTC
TCTACCATATGTGCTGTCATCTTCTGATGACATGCTTATAAAGCTATGGGACTGGGAGAAAGGATGGCTATGCACTCAAATCTTTGAGGG
GCATTCCCATTATGTGATG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan