ESTScan Details for Unigene SGN-U282101

Score 
101
Direction 
Forward
Predicted Peptide Sequence 
FEVVNHADPFDYEVQKNTNSGVXVTSTQSVKAQALFIPELKEECVEGISALCNVQIAGLIAEGGQEIPYTVSESDVNEGISLHL
Predicted Coding Sequence 
XXCTTTGAAGTGGTGAATCATGCTGATCCTTTTGACTATGAGGTGCAGAAAAACACCAATTCTGGAGTTXATGTTACTTCAACACAATCA
GTAAAAGCACAAGCTCTTTTTATACCAGAGCTCAAAGAGGAGTGTGTTGAAGGTATATCTGCCTTGTGCAATGTTCAAATTGCTGGGCTC
ATTGCTGAAGGCGGTCAGGAAATACCTTATACTGTTTCAGAATCTGATGTAAACGAAGGTATTTCTCTGCATCTGTGA\
Edits in Original Sequence 
(5')XXCTTTGAAGTGGTGAATCATGCTGATCtCTTTTGACTATGAGGTGCAGAAAAACACCAATTCTGGAGTTXATGTTACTTCAACAC
tAATCAGTAAAAGCACAAGCTCTTTTTATACCAGAGCTCAAAcGAGGAGTGTGTTGAAGGTATATCTGCCTTGTGCAATGTTCAAATTGC
TGGGCTCATTGCTGAAGcGCGGTCAGGAAATACCTTATACTGTTTCAGAATCTGATGTAAACGAAGGTATTTCTCTGCATCTGTGA\(3')
TCTTTAACCATCTCCTGTAAGACTGATCTCCGTCTTGAAAGGATGTCGAGAAACATAAGATCGATCCTCCAGTGTATACAGTGAAAAAG
AACATGCTCATGTGACTTGAGCCGGTGTATGAATACTTGTTTTTAGATGTGAATTTCTGGCATTAAACATGTAAATATATGTAGCTGTTA
GAAAGTGACAATATGCCACTTAGTTTATGTATTTCATTGTCATTTTCCTCTTTGGACGTTTCCCTAGTTCATTTTCACCCACTCCAACAA
AAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan