Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U282131

Score 
740
Direction 
Forward
Predicted Peptide Sequence 
MAXEAIEVIIGGGGYVPPIAPAYPPYSYSPPPQEPLCPLPPPPPEPLCPPPMPPPPPPEPLCPPPMSPPPPPPPIIPNPPKLSPPPPPPP
PTPNYLLASAISVIKRFRKTITSDPSGITKTWEGNDICKDPTKYIGFICNNNKVVAVNFNGRNFKGNPLSLKDFINGIPTLEIFHSNSNN
FTGEIPHNISTQSIPNLFELDLSTTNMLVF
Predicted Coding Sequence 
ATGGCAGXAGAAGCCATAGAAGTCATAATTGGTGGAGGAGGATATGTCCCTCCCATTGCTCCTGCTTATCCTCCATATTCATATTCTCCT
CCTCCACAAGAACCACTTTGCCCTCTTCCTCCCCCTCCTCCAGAACCACTTTGTCCCCCTCCCATGCCCCCACCTCCTCCTCCTGAGCCA
CTTTGTCCCCCTCCCATGTCACCCCCACCACCACCACCCCCAATAATTCCAAATCCTCCCAAACTATCTCCACCCCCACCCCCACCCCCA
CCCACCCCCAATTATCTACTAGCATCAGCCATAAGTGTCATTAAAAGATTTAGGAAGACAATAACTAGTGACCCCTCTGGCATTACAAAA
ACATGGGAAGGCAATGACATTTGCAAAGACCCAACCAAGTATATAGGTTTCATTTGCAACAATAACAAAGTTGTTGCTGTCAATTTCAAT
GGTAGAAACTTTAAGGGAAATCCTCTGTCTCTGAAAGATTTCATTAATGGAATCCCCACTCTGGAAATCTTCCATTCCAACTCCAACAAC
TTCACTGGAGAAATACCCCATAATATATCGACCCAGAGTATTCCTAATCTTTTCGAACTTGATTTGAGCACAACAAATATGTTGGTTTTT
\
Edits in Original Sequence 
ACTTTATTTCAACAGCTCAATTATTAGTAATACTCATCTTCTTTATCTCCTCATTCTTCCATGTAAATGCCTTAACTTCATCTGTCAAAA
(5')ATGGCAGXAGAAGCCATAGAAGTCATAATTGGTGGAGGAGGATATGTCCCTCCCATTGCTCCTGCTTATCCTCCATATTCATATTC
TCCTCCTCCACAAGAACCACTTTGCCCTCTTCCTCCCCCTCCTCCAGAACCACTTTGTCCCCCTCCCATGCCCCCACCTCCTCCTCCTGA
GCCACTTTGTCCCCCTCCCATGTCACCCCCACCACCACCACCCCCAATAATTCCAAATCCTCCCAAACTATCTCCACCCCCACCCCCACC
CCCACCCACCCCCAATTATCTACTAGCATCAGCCATAAGTGTCATTAAAAGATTTAGGAAGACAATAACTAGTGACCCCTCTGGCATTAC
AAAAACATGGGAAGGCAATGACATTTGCAAAGACCCAACCAAGTATATAGGTTTCATTTGCAACAATAACAAAGTTGTTGCTGTCAATTT
CAATGGTAGAAACTTTAAGGGAAATCCTCTGTCTCTGAAAGATTTCATTAATGGAATCCCCACTCTGGAAATCTTCCATTCCAACTCCAA
CAACTTCACTGGAGAAATACCCCATAATATATCGACCCAGAGTATTCCTAATCTTTTCGAACTTGATTTGAGCACAACAAATATGTTGGT
TTTT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan