ESTScan Details for Unigene SGN-U282152

Score 
503
Direction 
Forward
Predicted Peptide Sequence 
PNLDLINVVNYLAVNGQRLRVKVXEIRVIAGLLVVEKLAELFHKLGTVARSLNPQWNFGISVAEYIEGTATLASSLYNQALGVPTGPHGV
FRDYQVDAITMEISAKRVANYKNRPNELLLQGGRLVEGVIRSVNNLLEKFHQSFFLYLLTSPNKFVSVGVYMIPFALLVAPLPMVAASLF
ADSTRRISGMETKVASSPDIPVITFRSWRWLHAAKTVFIVHFWGAVXNITSTFSVSSTRFTTSDQPLKLDYPFSIHPLNLASDSGFLLFS
STHEPNSRKWNGPFLKSVTIAAACTGTFA
Predicted Coding Sequence 
XXGCCAAACCTCGATCTGATCAATGTTGTGAACTATTTGGCTGTAAATGGGCAACGATTACGGGTGAAGGTTGAXGAAATTAGGGTCATT
GCTGGACTCTTGGTGGTTGAGAAGCTGGCTGAACTGTTTCACAAACTGGGCACAGTGGCTAGAAGTTTGAATCCCCAATGGAACTTTGGT
ATTTCTGTTGCAGAATATATTGAAGGCACTGCTACACTTGCTAGCTCATTATATAATCAGGCACTGGGTGTTCCCACAGGTCCTCATGGT
GTTTTTCGAGATTATCAAGTTGATGCCATTACTATGGAGATCTCAGCAAAACGTGTAGCAAACTACAAAAACCGACCAAACGAGTTACTT
TTGCAAGGTGGCAGATTGGTTGAAGGAGTGATCCGTTCTGTAAATAATCTGCTTGAGAAGTTTCACCAGTCATTTTTTCTCTATCTTTTG
ACATCTCCGAATAAATTTGTGTCAGTTGGAGTCTACATGATACCGTTTGCCTTGCTTGTTGCTCCTCTTCCAATGGTCGCAGCTTCTCTT
TTCGCTGATTCTACCAGAAGGATTTCTGGGATGGAAACCAAGGTCGCATCTTCTCCTGATATCCCAGTCATCACATTTCGATCCTGGAGA
TGGCTTCATGCAGCGAAGACCGTGTTTATTGTCCACTTTTGGGGTGCCGTTGXTAACATTACTTCCACATTTTCTGTCTCTAGTACAAGA
TTCACCACCTCTGACCAACCTCTTAAGCTGGATTATCCTTTCAGCATTCACCCTCTTAATCTTGCAAGCGATTCTGGGTTCCTCCTTTTC
TCTTCTACACATGAACCGAACTCAAGGAAATGGAATGGACCCTTTTTGAAATCAGTCACAATTGCTGCTGCCTGTACTGGGACTTTTGCA
TAA\
Edits in Original Sequence 
(5')XXGCCAAACCTCGATCTGATCAATGTTGTGAACTATTTGGCTGTAAATGGGCAACGATTACGGGTGAAGGTTGAXGAAATTAGGGT
CATTGCTGGACTCTTGGTGGTTGAGAAGtCTGGCTGAACTGTTTCACAAACTGGGCACAGTGGCTAGAAGTTTGAATCCCCAATGGAACT
TTGGTATTTCTGTTGCAGAATATATTGAAGGCACTGCTACACTTGCTAGCTCATTATATAATCAGGCACTGGGTGTTCCCACAGGTCCTC
ATGGTGTTTTTCGAGATTATCAAGTTGATGCCATTACTATGGAGATCTCAGCAAAACGTGTAGCAAACTACAAAAACCGACCAAACGAGT
TACTTTTGCAAGGTGGCAGATTGGTTGAAGGAGTGATCCGTTCTGTAAATAATCTGCTTGAGAAGTTTCACCAGTCATTTTTTCTCTATC
TTTTGACATCTCCGAATAAATTTGTGTCAGTTGGAGTCTACATGATACCGTTTGCCTTGCTTGTTGCTCCTCTTCCAATGGTCGCAGCTT
CTCTTTTCGCTGATTCTACCAGAAGGATTTCTGGGATGGAAACCAAGGTCGCATCTTCTCCTGATATCCCAGTCATCACATTTCGATCCT
GGAGATGGCTTCATGCAGCGAAGACCGTGTTTATTGTCCACTTTTGGGGTGCCGTTGXTAACATTACTTCCACATTTTCTGTCTCTAGTA
CAAGATTCACCACCTCTGACCAACCTCTTAAGCTGGATTATCCTTTCAGCATTCACCCTCTTAATCTTGCAAGCGATTCTGGGTTCCTCC
TTTTCTCTTCTACACATGAACCGAACTCAAGGAAATGGAATGGACCCTTTTTGAAATCAGTCACAATTGCTGCTGCCTGTACTGGGACTT
TTGCATAA\(3')ATGTCACGTCCATAAACTTTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan