ESTScan Details for Unigene SGN-U282338

Score 
32
Direction 
Forward
Predicted Peptide Sequence 
VLKEPNVPKDTVRLRARAMKKLGTIFQGAKPMYRRDSSLRSENTDMVDSGPSSK
Predicted Coding Sequence 
GTCCTTAAAGAGCCCAATGTTCCTAAGGATACTGTCAGGCTACGTGCTAGGGCCATGAAAAAACTGGGGACAATTTTTCAGGGTGCGAAA
CCAATGTACAGAAGAGATAGCAGTTTGCGCAGTGAAAACACAGACATGGTTGATAGTGGTCCATCCTCTAAATGA\
Edits in Original Sequence 
TAAATGAATCTCTTACAAAAATATTCTCAAGTAACATTCCGTTATTGAAGTGAGCCAGCATGGTCTGAGCATTTCACTTTTCTTTATTAA
TCTGAACGCAACCAGCCTTTTATATTTTTATATCATCTTTGTGACTTCTGATACACTGAACGCTCTGTAACTTACGACAGCAAATTGTGC
AATTTTTACGTATTTATGAAATGAGGAGCCTCTTCATGTTTATTATCAAGCTCACTTGTTTGCTTCTCTTTTTTTTGCCTAG
(5')GTCC
TTAAAGAGCCCAATGTTCCTAAGGATACTGTCAGGCTACGTGCTAGGGCCATGAAAAAACTGGGGACAATTTTTCAGGGTGCGAAACCAA
TGTACAGAAGAGATAGCAGTTTGCGCAGTGAAAACACAGACATGGTTGATAGTGGTCCATCCTCTAAATGA\(3')AAAGTAATTTTCGC
GGTATTTTTGGTGTAGAGAGACTTATAACAGCTGTATCTGTGCTCGGGATTTGTTCAATGTTGTGTTATTACATTTAGGTATCTCTCTCT
TCTTCAGAAACAGTTTGAACCTTCTGTGACCAAAATCTCAATTTTTTGACATATTTCTTGTGAAAACATCCATTCGTGTAGACTGTATCT
CTTTATTCTTCATGATGTTGACCACATTTCTGATTCGTATTTGCATTTCAATGTACTGGTTTTTTTATATGAGTAGGGGAGCGTGATGAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan