ESTScan Details for Unigene SGN-U282417

Score 
480
Direction 
Forward
Predicted Peptide Sequence 
RPPQPPELQFQESSTFFSKIIALKGSAKLLRGDPCFKILILELNSSEIEDIVEKLSFENSESAVEFFFLLRNDYGFNHSRASHIAVAHVL
AKKQRFRAXEDSFTTFGSTRRFVVISNQALVQLIDMRAAFDSFQKWDSNHVVWDVLVSAYSHCQMVDDALFVFAKMNDFNIQASVFTYNN
LLYNLRHTDYIWDVYYDMKASGINPSEYTNSILIDGSVQTILDXKKQLILSEGLNVESLSLVLCLSMALCRVPX
Predicted Coding Sequence 
XXCCGACCACCACAACCACCAGAGCTGCAGTTTCAAGAATCTTCAACTTTTTTCTCCAAAATCATTGCACTXAAAGGCTCCGCAAAGCTT
TTACGAGGTGACCCATGTTTTAAAATTTTAATCTTGGAGCTAAATTCATCGGAGATTGAAGACATTGTTGAGAAACTGAGTTTTGAAAAT
TCCGAATCTGCCGTTGAGTTCTTCTTCTTATTGAGAAATGATTATGGGTTTAATCATTCCAGAGCTTCACACATTGCTGTTGCTCATGTT
TTGGCTAAAAAACAGAGGTTTAGAGCTXTTGAAGATTCATTTACAACATTTGGTTCAACAAGAAGATTTGTTGTGATTTCCAATCAGGCT
TTGGTTCAGCTCATTGATATGCGAGCTGCTTTTGATTCCTTTCAGAAATGGGACTCTAATCATGTTGTCTGGGATGTTCTGGTTTCTGCT
TATTCCCATTGTCAGATGGTTGATGATGCTCTCTTTGTTTTTGCAAAGATGAATGATTTCAATATCCAGGCTTCGGTATTTACATACAAT
AATTTGTTGTATAATTTGAGGCACACTGATTACATCTGGGATGTTTACTATGACATGAAAGCCAGTGGGATAAACCCGAGCGAGTACACT
AATTCCATTCTTATAGATGGGTCTGTGCAAACAATTCTTGATXTCAAAAAGCAGTTAATTTTGTCCGAAGGACTGAATGTAGAGAGTTTG
AGCCTTGTGTTGTGTCTTTCAATGGCTCTATGTCGAGTTCCTGXX\
Edits in Original Sequence 
(5')XXCCGACCACCACAACCACCAGAGCTGCAGTTTCAAGAATCTTCAACTTTTTTCTCCAAAATCATTGCACTXAAAGGCTCCGCAAA
GCTTTTACGAGGTGACCCATGTTTTAAAATTTTAATCTTGGAGCTAAATTCATCGGAGATTGAAGACATTGTTGAGAAACTGAGTTTTGA
AAATTCCGAATCTGCCGTTGAGTTCTTCTTCTTATTGAGAAATGATTATGGGTTTAATCATTCCAGAGCTTCACACATTGCTGTTGCTCA
TGTTTTGGCTAAAAAACAGAGGTTTAGAGCTXTTGAAGATTCATTTACAACATTTGGTTCAACAAGAAGATTTGTTGTGATTTCCAATCA
GGCTTTGGTTCAGCTCATTcGATATGCGAGCTGCTTTTGATTCgCTTTCAGAAATGGGACTCTAATCATGTTGTCTGGGATGTTCTGGTT
TCTGCTTATTCCCATTGTCAGATGGTTGATGATGCTCTCTTTGTTTTTGCAAAGATGAATGATTTCAATATCCAGGCTTCGGTATTTACA
TACAATAATTTGTTGTATAATTTGAGGCACACTGATTACATCTGGGATGTTTACTATGACATGAAAGCCAGTGGGATAAACCCGAGCGAG
TACACTAATTCCATTCTTATAGATGGGTCTGTGCAAACAATTCTTGATXTCAAAAAGCAGTTAATTTTGTCCGAAGGACTGAATGTAGAG
AGTTTGAGCCTTGTGTTGTGTCTTTCAATGGCTCTATGTCGAGTTCCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan