ESTScan Details for Unigene SGN-U282424

Score 
338
Direction 
Forward
Predicted Peptide Sequence 
DKKIFDTINVFLSFISLYYFTLFLDVHLRAFIINLHGPSQCFICHADGGSCSASFGATSSWIKPSHEVQRFSDHSGISFRTENPFFGAAQ
SHWLAVGHESSLSRISVAADYPDSVPDSPNYVGNSSYHPLEGMRDQRRVRDTELTAAEIARTTVEANSNALLIFPGTVHCEPHEQVSWAE
FQYVX
Predicted Coding Sequence 
XXCGACAAAAAGATCTTCGATACAATTAACGTTTTCCTCAGTTTCATTTCATTATACTACTTCACTCTGTTTCTTGATGTTCATCTCCGC
GCCTTCATCATCAATCTCCATGGTCCTTCACAATGTTTCATATGTCATGCTGATGGAGGTAGTTGCTCAGCATCATTTGGAGCTACAAGC
AGTTGGATCAAACCATCACACGAGGTTCAGAGATTCTCTGACCATTCAGGTATAAGTTTCAGGACTGAGAACCCTTTCTTCGGAGCTGCA
CAATCGCATTGGCTTGCTGTAGGACACGAGAGTAGCCTTTCAAGAATTTCAGTTGCAGCAGATTACCCAGATTCTGTTCCTGATTCCCCT
AACTATGTCGGCAACAGTAGCTATCACCCTCTTGAAGGAATGCGGGACCAGAGAAGAGTTCGTGATACTGAACTCACAGCTGCTGAAATA
GCAAGGACAACTGTTGAGGCTAATAGCAATGCATTGTTGATATTCCCTGGCACGGTTCATTGTGAACCTCACGAACAAGTGTCATGGGCA
GAATTTCAGTATGTGATX\
Edits in Original Sequence 
(5')XXCGACAAAAAGATCTTCGATACAATTAACGTTTTCCTCAGTTTCATTTCATTaATACTACTTCACTCTGTTTCTTGATGTTCATC
TCCGCGCCTTCATCATCAATCTCCATcGGTCCTTCACAATGTTTCATATGTCATGCTGATGGAGGTAGTTGCTCAGCATCATTTGGAGCT
ACAAGCAGTTGGATCAAACCATCACACGAGGTTCAGAGATTCTCTGACCATTCAGGTATAAGTTTCAGGACTGAGAACCCTTTCTTCGGA
GCTGCACAATCGCATTGGCTTGCTGTAGGACACGAGAGTAGCCTTTCAAGAATTTCAGTTGCAGCAGATTACCCAGATTCTGTTCCTGAT
TCCCCTAACTATGTCGGCAACAGTAGCTATCACCCTCTTGAAGGAATGCGGGACCAGAGAAGAGTTCGTGATACTGAACTCACAGCTGCT
GAAATAGCAAGGACAACTGTTGAGGCTAATAGCAATGCATTGTTGATATTCCCTGGCACGGTTCATTGTGAACCTCACGAACAAGTGTCA
TGGGCAGAATTTCAGTATGTGATX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan