ESTScan Details for Unigene SGN-U282448

Score 
284
Direction 
Forward
Predicted Peptide Sequence 
ERTSARISVSDGTLTIIAKNQSVMEKVQEKVDFIIGREIEIGGVYKGIVVSVKEYGAFVEFNGGXTGPLTYFRIVTRPGFQSFRCGICGT
ATFFNVYRTGLRGNINLSLKATLPRPKSKTDISVDEPVAPTSQEVNVWAAIEDVSNELENKXATVGPETNDSTLKSATPAVLIPSAGIVD
EDEKSDALNLKVIMDX
Predicted Coding Sequence 
GAGAGAACTAGTGCACGGATCTCGGTTAGTGATGGAACACTTACTATAATTGCCAAAAATCAGTCGGTGATGGAGAAAGTACAGGAGAAG
GTTGATTTTATAATTGGACGTGAAATTGAGATTGGAGGCGTATATAAAGGTATTGTTGTATCTGTTAAAGAATATGGCGCCTTTGTGGAG
TTTAATGGTGGAXCAACAGGGCCTCTTACATATTTCAGAATTGTCACACGACCCGGTTTCCAGAGTTTCAGATGTGGTATCTGTGGGACA
GCAACTTTCTTTAATGTGTATAGGACAGGACTTCGTGGTAATATTAATTTATCATTAAAAGCCACCCTGCCTAGACCTAAATCTAAGACA
GACATTTCTGTTGATGAACCTGTTGCTCCTACTAGTCAAGAGGTTAATGTTTGGGCTGCCATTGAGGATGTATCCAATGAGCTAGAAAAC
AAGGXTGCTACTGTGGGACCTGAAACTAATGATTCAACTTTGAAGTCAGCTACACCAGCAGTTCTAATCCCAAGTGCXGGCATAGTTGAT
GAGGATGAAAAAAGCGATGCTCTGAATTTGAAAGTGATAATGGATCXX\
Edits in Original Sequence 
(5')GAGAGAACTAGTGCACGGATCTCGGTTAGTGATGGAACACTTACTATAATTGCCAAAAATCAGTCGGTGATGGAGAAAGTACAGGA
GAAGGTTGATTTTATAATTGGACGTGAAATTGAGATTGGAGGCGTATATAAAGGTATTGTTGTATCTGTTAAAGAATATGGCGCCTTTGT
GGAGTTTAATGGTGGAXCAACAGGGCCTCTTACATATTTCAGAATTGTCACACGACCCGGTTTCCAGAGTTTCAGATGTGGTATCTGTGG
GACAGCAACTTTCTTTAATGTGTATAGGACAGGACgTTCGTGGTAATATTAATTTATCATTAAAAGCCACCCTGCCTAGACCTAAATCTA
AGACAGACATTTCTGTTGATGAACCTGTTGCTCCTACTAGTCAAGAGGTTAATGTTTGGGCTGCCATTGAGGATGTATCCAATGAGCTAG
AAAACAAGGXTGCTACTGTGGGACCTGAAACTAATGATTCAACTTTGAAGTCAGCTACACCAGCAGTTCTAATCCCAAGTGCXGGCATAG
TgTGATGAGGATGAAAAAAGCGATGCTCTGAATTTGAAAGTGATAATGGATCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan