ESTScan Details for Unigene SGN-U282450

Score 
424
Direction 
Forward
Predicted Peptide Sequence 
SHHTSSVSPPPAPHVPLPLFPLVETLSTPPPALSGTTETTPLPSSSLTEAFSDGDTPRMRLERVVGRVPNFTCFSVKLRGFDFSNSSQVI
NYILISRLKGVKPALETTTLFKGVLKAGKXIMGAVKLQLPLPKSVDGVTLDPNPDWTFDALLVELNSIEKKLNASSKFPIPFTKTESRQL
SASKDNSRRGFVMQVSDDDVEDMDRDTKHEVGDHLLMGGKRFACDEIYLSDGDQSEEGLNIELQHDLMDKVGLVESALSEFSXMTSAY
Predicted Coding Sequence 
XXCTCTCACCACACCTCCTCCGTCTCTCCACCACCGGCTCCACACGTTCCTCTCCCTCTCTTCCCCCTTGTTGAAACCCTAAGCACCCCA
CCGCCTGCATTGTCCGGAACCACCGAGACCACCCCGCTCCCTTCCTCTTCTTTAACAGAAGCCTTCTCCGACGGGGACACTCCAAGAATG
AGGCTCGAGAGGGTTGTTGGTCGAGTTCCAAACTTCACCTGTTTCTCTGTTAAGCTTCGAGGTTTCGATTTCTCAAATTCATCCCAGGTA
ATTAATTATATTTTAATTTCAAGACTCAAGGGTGTGAAGCCGGCGTTGGAAACAACAACTTTATTCAAAGGTGTTCTTAAGGCAGGAAAA
GAXATAATGGGTGCTGTTAAACTGCAACTTCCGTTGCCTAAAAGTGTTGATGGAGTCACCCTGGATCCAAATCCTGATTGGACCTTTGAT
GCTTTATTGGTTGAGCTCAATTCGATTGAGAAGAAGCTCAATGCATCATCAAAATTTCCAATACCTTTTACGAAAACAGAATCGCGACAA
CTCTCGGCTTCAAAGGATAATTCTCGGAGAGGCTTTGTTATGCAAGTGTCTGATGATGACGTGGAGGATATGGACAGAGATACTAAGCAT
GAAGTTGGTGATCATTTACTTATGGGAGGAAAACGGTTTGCCTGTGACGAAATCTATCTGAGTGATGGCGACCAATCTGAAGAAGGCCTA
AACATTGAACTTCAACATGATCTAATGGATAAAGTGGGATTAGTGGAAAGTGCTTTATCTGAGTTTAGCTXCATGACATCAGCTTAC\
Edits in Original Sequence 
(5')XXCTCTCACCACACCTCCTCCGTCTCTCCACCACCGGCTCCACACGTTCCTCTCCCTCTCTTCCCCCTTcGTTGAAACCCTAAGCA
CCCCACCGCCTGCATTGTCCGGAACCACCGAGACCACCCCGCTCCCTcTCCTCTTCTTTAACAGAAGCCTTCTCCGACGGGGACACTCCA
AGAATGAGGCTCGAGAGGGTTGTTGGTCGAGTTCCAtAACTTCACCTGTTTCTCTGTTAAGCTTCGAGGTTTCGATTTCTCAAATTCATC
CCAGGTAATTAATTATATTTTAATTTCAAGACTCAAGGGTGTGAAGCCGGCGTTGGAAACAACAACTTTATTCAAAGGTGTTCTTAAGGC
AGGAAAAGAXATAATGGGTGCTGTTAAACTGCAACTTCCGTTGCCTAAAAGTGTTGATGGAGTCACCCTGGATCCAAATCCTGATTGGAC
CTTTGATGCTTTATTGGTTGAGCTCAATTCGATTGAGAAGAAGCTCAATGCATCATCAAAATTTCCAATACCTTTTACGAAAACAGAATC
GCGACAACTCTCGGCTTCAAAGGATAATTCTCGGAGAGGCTTTGTTATGCAAGTGTCTGATGATGACGTGGAGGATATGGACAGAGATAC
TAAGCATGAAGTTGGTGATCATTTACTTATGGGAGGAAAACGGTTTGCCTGTGACGAAATCTATCTGAGTGATGGCGACCAATCTGAAGA
AGGCCTAAACATTGAACTTCAACATGATCTAATGGATAAAGTGGGATTAGTGGAAAGTGCTTTATCTGAGTTTAGCTXCATGACATCAGC
TTAC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan