ESTScan Details for Unigene SGN-U282523

Score 
465
Direction 
Forward
Predicted Peptide Sequence 
RLLIMVGGNTFAKTICSICYEDLKPVVEDLQSISLCGHVFHELCLQQWFEYCTNGKKKNCPVCKQTCTEKNTHRLFFQSVGDPNDLSLSQ
QPHDFEGGTSCELQNEVKRLEGKVLKLASTLEQQQKDIKEVNAELFSCKEQLKVEVALKNEAKQQKTASQQLLHVKSQELDQSTLECRRL
QERSMALAKELAALKLVCDVNLGEEEVLKLASLGNEANSKETIGVLKKSLIILNKSYKELRPNATPLGGGRARSLSKLEKAIEKIDKLKT
RVX
Predicted Coding Sequence 
CGGCTTCTAATAATGGTAGGAGGCAACACATTTGCCAAGACCATTTGTTCAATCTGCTATGAGGATCTCAAACCTGTAGTCGAAGACCTT
CAATCCATTTCTCTTTGCGGCCATGTTTTTCACGAGCTCTGTCTGCAGCAATGGTTTGAGTATTGCACAAATGGAAAGAAGAAGAATTGT
CCAGTTTGCAAACAGACTTGTACAGAGAAAAACACACATAGGCTTTTTTTTCAATCAGTTGGTGATCCAAATGATCTTAGTCTTTCCCAG
CAACCACATGACTTTGAAGGGGGGACTTCCTGTGAATTACAAAATGAGGTCAAAAGGTTAGAGGGGAAAGTCTTAAAACTGGCTTCTACT
CTGGAACAGCAACAAAAAGATATCAAAGAAGTTAATGCTGAGTTGTTCAGTTGCAAAGAGCAGTTGAAAGTAGAAGTGGCTCTAAAGAAT
GAAGCTAAACAACAGAAGACAGCCAGTCAGCAGTTACTTCATGTTAAATCTCAGGAGCTAGATCAATCAACCTTGGAATGCAGACGACTG
CAAGAAAGAAGTATGGCCCTAGCTAAGGAGCTTGCAGCACTCAAGCTAGTCTGTGATGTGAACTTGGGGGAAGAAGAAGTCCTGAAGCTT
GCTTCATTGGGCAATGAGGCCAACAGTAAAGAGACAATTGGCGTCTTGAAAAAGTCACTGATCATCCTTAACAAGAGTTACAAAGAATTG
AGACCAAATGCAACACCCTTGGGAGGGGGGAGGGCTCGTTCTCTTAGTAAGCTTGAGAAGGCTATAGAGAAGATAGATAAGCTCAAGACA
AGGGTCCAX\
Edits in Original Sequence 
(5')CGGCTTCTAATAATGGTAGGAGGCAACACATTTGCCAAGACCATTTGTTCAATCTGCTATGAGGATCTCAAACCTGTAGTCGAAGA
CCTTCAATCCATTTCTCTTTGCGGCCATGTTTTTCACGAGCTCTGTCTGCAGCAATGGTTTGAGTATTGCACAAATGGAAAGAAGAAGAA
TTGTCCAGTTTGCAAACAGACTTGTACAGAGAAAAACACACATAGGCTTTTTTTTCAATCAGTTGGTGATCCAAATGATCTTAGTCTTTC
CCAGCAACCACATGACTTTGAAGGGGGGACTTCCTGTGAATTACAAAATGAGGTCAAAAGGTTAGAGGGGAAAGTCTTAAAACTGGCTTC
TACTCTGGAACAGCAACAAAAAGATATCAAAGAAGTTAATGCTGAGTTGTTCAGTTGCAAAGAGCAGTTGAAAGTAGAAGTGGCTCTAAA
GAATGAAGCTAAACAACAGAAGACAGCCAGTCAGCAGTTACTTCATGTTAAATCTCAGGAGCTAGATCAATCAACCTTGGAATGCAGACG
ACTGCAAGAAAGAAGTATGGCCCTAGCTAAGGAGCTTGCAGCACTCAAGCTAGTCTGTGATGTGAACTTGGGGGAAGAAGAAGTCCTGAA
GCTTGCTTCATTGGGCAATGAGGCCAACAGTAAAGAGACAATTGGCGTCTTGAAAAAGTCACTGATCATCCTTAACAAGAGTTACAAAGA
ATTGAtGACCAAATGCAACACCCTTGGGAGGGGGGAGGGCTCGTTCTCTTAGTAAGCTTGAGAAGGCTATAGAGAAGATAGATAAGCTCA
AGACAAGGGTCCAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan