ESTScan Details for Unigene SGN-U282671

Score 
474
Direction 
Forward
Predicted Peptide Sequence 
VLEGIVRIGSPICIPQKDFIDIGRIASIENNHKPVDSAKKGQRVAIKIVGSNPEEQQKMFGRHFEMEDELVSKISRRSIDILKANFRRDL
SVEDWRLVMKLKTLFXDTMRQVFVAFKGVGSWFSDKHHRRGLAAHRAISGDLTVNKSLDPMFMHLRDRNEQKXKNAIGVAAATDFFWLVS
EHSVYAVFGTEVRIFATLTNGRVVQGHKIATAFFMIQKCDFDFDIQKPVQKIIGWLLLASFSY
Predicted Coding Sequence 
GTTCTTGAGGGCATTGTCAGGATTGGATCTCCTATATGTATTCCTCAAAAGGACTTCATTGATATTGGTCGTATTGCATCCATTGAGAAC
AACCATAAGCCTGTTGATTCTGCAAAGAAAGGCCAAAGGGTGGCCATTAAGATAGTTGGATCTAACCCTGAGGAGCAACAAAAGATGTTT
GGTAGGCATTTTGAAATGGAAGATGAGCTTGTCAGCAAAATTTCAAGGAGGTCTATTGACATACTCAAGGCCAATTTCCGGAGAGACCTC
TCAGTTGAGGATTGGAGACTTGTCATGAAACTGAAGACCCTCTTTAAXGATACAATGAGACAGGTTTTTGTAGCTTTCAAAGGGGTTGGT
TCTTGGTTCTCCGATAAGCACCATCGTAGGGGCTTAGCAGCTCATCGAGCAATAAGTGGTGATTTGACTGTAAACAAGAGTTTGGACCCA
ATGTTCATGCACCTCAGAGACAGAAATGAGCAAAAGXTGAAGAATGCAATTGGTGTTGCTGCTGCAACTGATTTCTTTTGGTTAGTCTCC
GAGCATTCTGTATATGCTGTTTTTGGTACTGAAGTGAGGATTTTTGCCACATTGACCAATGGCAGAGTTGTACAGGGGCATAAAATAGCA
ACXGCATTTTTCATGATACAGAAATGTGATTTTGACTTTGATATACAAAAACCXGTGCAAAAGATTATTGGTTGGCTATTGTTGGCAAGT
TTTTCATATTAG\
Edits in Original Sequence 
(5')GTTCTTGAGGGCATTGTCAGGATTGGATCTCCTATATGTATTCCTCAAAAGGACTTCATTGATATTGGTCGTATTGCATCCATTGA
GAACAACCATAAGCCTGTTGATTCTGCAAAGAAAGGCCAAAGGGTGGCCATTAAGATAGTTGGATCTAACCCTGAGGAGCAACAAAAGAT
GTTTGGTAGGCATTTTGAAATGGAAGATGAGCTTGTCAGCAAAATTTCAAGGAGGTCTATTGACATACTCAAGGCCAATTTCCGGAGAGA
CCTCTCAGTTGAGGATTGGAGACTTGTCATGAAACTGAAGACCCTCTTTAAXGATACAATGAGACAGGTTTTTGTAGCTTTCAAAGGGGT
TGGTTCTTGGTTCTCCGATAAGCACCATCGTAGGGGCTTAGCAGCTCATCGAGCAATAAGTGGTGATTTGACTGTAAACAAGAGTTTGGA
CCCAATGTTCATGCACCTCAGAGACAGAAATGAGCAAAAGXTGAAGAATGCAATTGGTGTTGcCTGCTGCAACTGATTTCTTTTGGTTAG
TaCTCCGAGCATTCTGTATATGCTGTTTTTGGTACTGAAGTGAGGATTTTTGCCACATTGACCAATGGCAGAGTTGTACAGGGGCATAAA
ATAGCAACXGCATTTTTCATGATACAGAAATGTGATTTTGACTTTGATATACAAAAACCXGTGCAAAAGATTATTGGTTGGCTATTGTTG
GCAAGTTTTTCATATTAG\(3')TATCAATCCAATCCTTTTTATAGAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan