Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U282743

Score 
190
Direction 
Forward
Predicted Peptide Sequence 
MEFKERLPSYYGVLGVNVDSSDEEIRRAYRKLAMQWHPDKWTXTPSLLGEAKRKFX
Predicted Coding Sequence 
ATGGAGTTTAAAGAAAGGTTGCCTTCATATTATGGTGTACTTGGTGTAAATGTTGATTCTTCTGATGAAGAGATTAGACGTGCTTATAGA
AAGTTAGCAATGCAATGGCACCCTGATAAATGGACTANGACACCATCATTGTTAGGTGAAGCTAAGAGGAAGTTTCXX\
Edits in Original Sequence 
GGAACCTTCTTGAAGCTTTATTGTTTATTCCCCAGAACCCAATGGAACCTTTTTCCACCTCATAGATATTTCTATCTATCCATGTGGCTG
CTGATTTTTTTGACAAACAAAGTTCCATTGGACCCCACTTCATCACCGACTTTAAAAATTCTTTCTTTATATAAATGGTTTCCTTAACAC
ACTTTTTATGTCACATTTTCTTGATTTTCAGTTTTTGGGTTGTTAAAGATCTGATCTTTTTGACAAAATATTTAAACTGGAGGATACCCT
TTTGCTTATTTGTTGTTATTTTGTGGGAATTTGATGAATTTAGAAAAAGGGGTTGTTAAAGATTTGATTTTTTTGAAGAAATATTAAAAT
TAGAGGACACCCTTTTGCTTATTTGTTGTTATTTTGTGGGAATTTGGTGATTTTAGAAAAAGGGGTTGTTAAAAGATTTGATTTTTTTGA
AGAAATATTGAAATTAGAGGATACCCTTTTGGTTATTTGGTGAATGGAG
(5')ATGGAGTTTAAAGAAAGGTTGCCTTCATATTATGGTG
TACTTGGTGTAAATGTTGATTCTTCTGATGAAGAGATTAGACGTGCTTATAGAAAGTTAGCAATGCAATGGCACCCTGATAAATGGACTA
NGACACCATCATTGTTAGGTGAAGCTAAGAGGAAGTTTCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan