ESTScan Details for Unigene SGN-U282840

Score 
49
Direction 
Reverse
Predicted Peptide Sequence 
MFHIDELNEEQFNNYIYSNKRALRPSHFTWPLYHHFNSETDAEKYNEEYDKGTASLKNENDKAEKHNLISSKYFNESLGSRGIVRGMSKV
RMSLLSQFTKRIFISSKELVSDTPEARKXLGPANSERIGSAPVGATDL
Predicted Coding Sequence 
ATGTTCCATATTGATGAATTAAACGAAGAACAATTCAACAACTATATTTATTCTAATAAGAGAGCACTCCGTCCATCTCACTTTACTTGG
CCCCTGTACCACCATTTTAACTCGGAAACTGATGCAGAAAAATATAATGAGGAATATGATAAAGGAACAGCGTCACTGAAAAATGAAAAC
GATAAGGCAGAAAAGCATAACCTCATAAGCAGCAAGTATTTCAACGAATCGCTTGGAAGTAGAGGAATTGTGCGTGGAATGAGCAAGGTC
AGGATGAGTCTCCTTAGCCAATTTACGAAAAGAATTTTTATTTCATCAAAGGAGCTTGTTTCTGATACACCAGAAGCTCGTAAGXCATTA
GGTCCAGCAAATTCTGAACGAATCGGTTCAGCTCCTGTAGGAGCCACCGATTTGTGATAA\
Edits in Original Sequence 
ATACTTCGCAAACATAGGTAAAGCTAAACATCCAATGTTCTACTATACAAAATTTTAAATCCTCAGTTTGTGCTAATAACAA(5')ATGT
TCCATATTGATGAATTAAACGAAGAACAATTCAACAACTATATTTATTCTAATAAGAGAGCACTCCGTCCATCTCACTTTACTTGGCCCC
TGTACCACCATTTTAACTCGGtAAACTGATGCAGAAAAATATAATGAGGAATATGATAAAGGAACAGCGTCACTGAAAAATGAAAACGAT
AAGGCAGAAAAcGCATAACCTCATAAGCAGCAAGTATTTCAACGAATCGCTTGGAAGTAGAGGAATTGTGCGTGGAATGAGCAAGGTCAG
GATGAGTCTCCTTAGCCAATTTACGAAAAGAATTTTTATTTCATCAAAGGAGCTTGTTTCTGATACACCtAGAAGCTCGTAAGXCATTAG
GTCCAGCAAATTCTGAACGAATCGGTTCAGCTCCTGTAGtGAGCCACCGATTTGTGATAA\(3')ATCGGGGATAACATTTGTGTAGCAG
CAGAGACATAGTCATGTAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan