ESTScan Details for Unigene SGN-U282979

Score 
326
Direction 
Forward
Predicted Peptide Sequence 
LPPKTLNPKFKNSHNNQNAHFPFDFLKIITVKIHILQVPHMDSYSFLTIPKANVTVNFHTQKQQRIRDHGYDDYMEVEKKIRKVMKFQEL
LLTQPNSMIAISRLDMLARRFGFKQYEAGKFIXQIPHVFEVFEHPVQRILYCRLTRKSLLQIEQEX
Predicted Coding Sequence 
CTTCCTCCTAAAACCCTAAACCCCAAATTCAAGAACTCACATAATAATCAAAATGCACATTTTCCTTTCGATTTCCTCAAAATTATTACA
GTCAAAATCCACATCCTTCAAGTCCCTCACATGGATTCCTACAGTTTTCTTACTATCCCCAAAGCAAATGTCACAGTCAACTTCCATACC
CAGAAACAACAGCGTATTCGCGACCACGGCTACGATGATTACATGGAAGTGGAGAAGAAAATCCGTAAAGTAATGAAATTCCAAGAACTA
CTTCTTACTCAACCAAATTCAATGATCGCCATTTCTCGCCTTGATATGCTTGCTCGCCGTTTTGGGTTCAAACAATATGAAGCAGGGAAG
TTTATTXCTCAAATTCCTCATGTTTTCGAGGTATTCGAACACCCAGTTCAGAGAATATTATATTGCAGGCTTACTCGTAAATCACTGCTT
CAAATTGAGCAAGAAAXX\
Edits in Original Sequence 
(5')CTTCCTCCTAAAACCCTAAACCCCAAATTCAAGAACTCACATAATAATCAAAATGCACATTTTCCTTTCGATTTCCTCAAAATTAT
TACAGTCAAAATCCACATCCTTCAAGTCCCTCACATGGATTCCTACAGTTTTCTTACTATCCCCAAAGCAAATGTCACAGTCAACTTCCA
TACCCAGAAACAACAGCGTATTCGCGACCACGGCTACGATGATTACATGGAAGTGGAGAAGAAAATCCGTAAAGTAATGAAATTCCAAGA
ACTACTTCTTACTCAACCAAATTCAATGATCGCCATTTCTCGCCTTGATATGCTTGCTCGCCGTTTTGGGTTCAAACAATATGAAGCAGG
GAAGTTTATTXCTCAAATTCCTCATGTTTTCGAGGTATTCGAACACCCAGTTCAGAGAATATTATATTGCAGGCTTACTCGTAAATCACT
GCTTCAAATTGAGCAAGAAAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan