ESTScan Details for Unigene SGN-U283036

Score 
927
Direction 
Forward
Predicted Peptide Sequence 
GYSLFACSLDGSVATFHFDEKELGHQLSDAELEELKRSRYGDVRGRQANLAESPAQLLLEAAAAKQTSSKKLTTDLPQVQATSKSSVDLG
SVVIVPKPKSDNGKKTEGVNSDSLAKPAASTRLSSPVKQREYRRPDGRKRIIPESVGFPTLQENTSGIAQSPVVEFPNMTVEQRKDENGM
VLSDASVREVFARKTVSVSADQRERSGVTARGTISDSLIIEKVPPSAGKDGSISIEQMGIVKDPSHLGTGGTLLIRVFDNKEGVDTGPIC
X
Predicted Coding Sequence 
XXTGGATATTCACTGTTTGCATGTTCTTTGGATGGAAGTGTAGCCACTTTCCATTTTGATGAGAAAGAACTAGGTCATCAGCTTTCTGAT
GCTGAATTAGAGGAGTTGAAGAGAAGCCGCTATGGTGATGTTAGAGGTCGACAAGCAAATTTAGCTGAAAGTCCAGCACAACTATTGCTT
GAAGCAGCAGCTGCAAAGCAAACTTCAAGCAAAAAACTAACTACGGATCTTCCACAAGTTCAAGCAACGTCAAAATCTTCTGTTGATTTG
GGTAGTGTGGTGATTGTTCCCAAACCAAAATCTGATAATGGGAAAAAGACTGAAGGAGTTAACAGTGATAGTTTAGCTAAACCCGCAGCT
TCTACACGCTTGTCAAGTCCCGTGAAGCAAAGAGAGTACAGAAGGCCTGATGGTCGAAAGAGGATAATTCCAGAATCAGTTGGTTTTCCT
ACCCTGCAGGAGAACACCTCTGGAATTGCTCAATCTCCTGTCGTTGAATTTCCTAATATGACAGTGGAGCAGAGGAAAGATGAGAATGGT
ATGGTACTGTCTGATGCAAGTGTTAGAGAAGTATTTGCAAGGAAAACAGTTAGTGTCAGTGCTGATCAAAGGGAGCGCTCAGGTGTAACT
GCTAGAGGTACCATCAGTGATAGCCTCATCATTGAGAAGGTTCCACCTTCTGCAGGCAAGGATGGAAGTATCAGCATTGAACAGATGGGA
ATTGTCAAAGATCCATCTCATTTGGGTACTGGTGGTACACTTTTAATCAGGGTTTTTGATAATAAAGAAGGGGTGGACACTGGTCCAATT
TGCTTX\
Edits in Original Sequence 
(5')XXTGGATATTCACTGTTTGCATGTTCTTTGGATGGAAGTGTAGCCACTTTCCATTTTGATGAGAAAGAACTAGGTCATCAGCTTTC
TGATGCTGAATTAGAGGAGTTGAAGAGAAGCCGCTATGGTGATGTTAGAGGTCGACAAGCAAATTTAGCTGAAAGTCCAGCACAACTATT
GCTTGAAGCAGCAGCTGCAAAGCAAACTTCAAGCAAAAAACTAACTACGGATCTTCCACAAGTTCAAGCAACGTCAAAATCTTCTGTTGA
TTTGGGTAGTGTGGTGATTGTTCCCAAACCAAAATCTGATAATGGGAAAAAGACTGAAGGAGTTAACAGTGATAGTTTAGCTAAACCCGC
AGCTTCTACACGCTTGTCAAGTCCCGTGAAGCAAAGAGAGTACAGAAGGCCTGATGGTCGAAAGAGGATAATTCCAGAATCAGTTGGTTT
TCCTACCCTGCAGGAGAACACCTCTGGAATTGCTCAATCTCCTGTCGTTGAATTTCCTAATATGACAGTGGAGCAGAGGAAAGATGAGAA
TGGTATGGTACTGTCTGATGCAAGTGTTAGAGAAGTATTTGCAAGGAAAACAGTTAGTGTCAGTGCTGATCAAAGGGAGCGCTCAGGTGT
AACTGCTAGAGGTACCATCAGTGATAGCCTCATCATTGAGAAGGTTCCACCTTCTGCAGGCAAGGATGGAAGTATCAGCATTGAACAGAT
GGGAATTGTCAAAGATCCATCTCATTTGGGTACTGGTGGTACACTTTTAATCAGGGTTTTTGATAATAAAGAAGGGGTGGACACTGGTCC
AATTTGCTTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan