ESTScan Details for Unigene SGN-U283393

Score 
642
Direction 
Forward
Predicted Peptide Sequence 
LEADNTTEYAAYERGGIVTQVKEPKVLKFNPLRKAISDPGDFLLSDFSKFXPPTYFALDLSSPDKFVSLSGRFPVAGSEEDAQRLISLVT
DMNNSQDAKVEIDHKLIRNFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTEPLDPNDLKPLNSRYDAQISVF
GNKLQQKLEEAKAFVVGSGALGCEFLKNLALMGX
Predicted Coding Sequence 
CTGGAGGCCGATAATACCACAGAGTATGCAGCATATGAAAGAGGGGGTATCGTCACTCAGGTCAAGGAGCCTAAAGTGTTAAAGTTCAAC
CCACTGCGTAAAGCAATTAGCGATCCTGGTGACTTTCTTCTGAGTGACTTCTCAAAGTTTGXACCGCCCACCTATTTTGCACTTGACCTT
TCAAGCCCTGATAAGTTTGTGTCTTTATCAGGACGTTTTCCTGTTGCTGGATCTGAGGAAGATGCTCAGAGGCTAATCTCACTTGTGACT
GACATGAACAATAGTCAAGATGCAAAAGTTGAGATTGACCATAAACTTATTCGTAACTTTGCATTTGGTGCAAGGGCTGTGCTAAACCCA
ATGGCGGCTATGTTTGGGGGTATCGTTGGGCAAGAAGTTGTGAAGGCTTGCTCTGGGAAGTTCCATCCACTATACCAGTTTTTCTACTTT
GACTCTGTTGAATCTCTTCCAACTGAACCATTGGATCCAAATGATTTGAAGCCCTTGAATAGTCGTTATGATGCCCAAATCTCAGTTTTC
GGAAACAAGCTACAGCAGAAGCTGGAAGAGGCAAAAGCTTTTGTAGTTGGGTCTGGTGCACTTGGGTGTGAGTTCTTGAAGAATTTAGCT
CTCATGGGGGXX\
Edits in Original Sequence 
(5')CTGGAGGCCGATAATACCACAGAGTATGCAGCATATGAAAGAGGGGGTATCGTCACTCAGGTCAAGGAGCCTAAAGTGTTAAAGTT
CAACCCACTGCGTAAAGCAATTAGCGATCCTGGTGACTTTCTTCTGAGTGACTTCTCAAAGTTTGXACCGCCCACCTATTTTGCACTTGA
CCTTTCAAGCCCTaGATAAGTTTGTGTCTTTATCAGGACGTTTTCCTGTTGCTGGATCTGAGGAAGATGCTCAGAGGCTAATCTCACTTG
TGACTGACATGAACAATAGTCAAGATGCAAAAGTTGAGATTGACCATAAACTTATTCGTAACTTTGCATTTGGTGCAAGGGCTGTGCTAA
ACCCAATGGCGGCTATGTTTGGGGGTATCGTTGGGCAAGAAGTTGTGAAGGCTTGCTCTGGGAAGTTCCATCCACTATACCAGTTTTTCT
ACTTTGACTCTGTTGAATCTCTTCCAACTGAACCATTGGATCCAAATGATTTGAAGCCCTTGAATAGTCGTTATGATGCCCAAATCTCAG
TTTTCGGAAACAAGCTACAGCAGAAGCTGGAAGAGGCAAAAGCTTTTGTAGTTGGGTCTGGTGCACTTGGGTGTGAGTTCTTGAAGAATT
TAGCTCTCATGGGGGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan