ESTScan Details for Unigene SGN-U283402

Score 
-19
Direction 
Forward
Predicted Peptide Sequence 
KGSHLAGLIGHVDAGKSTTTGHLIYKAAVSDKRTIEKFEKEAAELGKTSFKYAWVLDNLKAERERGITIDIALWKFESPKYFFTVIDAPG
HRDFIKNMITGTSQAXLRHSGGASGVGEFEAGISKEGQTREHALLAFTLGVKQMVVAINKMDDSSVMYGQARYEEIKSEVTTYLKKVGYK
PAKIPFVPISGWEGDNMIDRSTNMPWYKGPFLLEALDNLNAPKRPSDKPLR
Predicted Coding Sequence 
XXAAAAGGTTCACATCTCGCTGGTCTCATTGGCCACGTCGACGCCGGTAAGTCGACCACCACCGGTCACTTGATCTACAAGGCGGCGGTA
TCXGACAAGCGTACCATCGAGAAGTTCGAGAAGGAGGCTGCCGAGCTCGGCAAGACCTCGTTCAAGTACGCCTGGGTGCTTGACAACCTG
AAGGCCGAGCGTGAGCGTGGTATCACGATCGACATTGCCCTGTGGAAGTTCGAGTCCCCCAAGTACTTCTTCACGGTCATTGACGCCCCT
GGTCACCGTGACTTCATCAAGAACATGATTACGGGTACCTCGCAGGCCGAXTTGCGCCATTCTGGTGGTGCTTCGGGTGTGGGTGAGTTC
GAGGCTGGTATCTCCAAGGAGGGCCAGACTCGTGAGCACGCTCTGCTTGCCTTCACTCTGGGTGTGAAGCAGATGGTCGTCGCCATCAAC
AAGATGGACGACTCGTCTGTCATGTACGGCCAGGCCCGTTACGAGGAGATCAAGTCTGAGGTCACCACGTACCTAAAGAAGGTTGGCTAC
AAGCCCGCCAAGATCCCGTTCGTGCCTATCTCCGGCTGGGAGGGTGACAACATGATCGACCGCTCCACCAACATGCCGTGGTACAAGGGA
CCTTTCCTCCTTGAGGCTCTTGACAACCTGAACGCCCCCAAGCGCCCGTCGGACAAGCCGCTGCGT\
Edits in Original Sequence 
(5')XXAAAAGGTTCACATCTCGCTGGTCgTCATTGGCCACGTCGACGCCGGTAAGTCGACCACCACCGGTCACTTGATCTACAAGtGCG
GCGGTATCXGACAAGCGTACCATCGAGAAGTTCGAGAAGGAGGCTGCCGAGCTCGGCAAGACCTCGTTCAAGTACGCCTGGGTGCTTGAC
AACCTGAAGGCCGAGCGTGAGCGTGGTATCACGATCGACATTGCCCTGTGGAAGTTCGAGTCCCCCAAGTACTTCTTCACGGTCATTGAC
GCCCCTGGTCACCGTGACTTCATCAAGAACATGATTACGGGTACCTCGCAGGCCGAXTTGCGCCATTCTGGTGGTcGCTTCGGGTGTGGG
TGAGTTCGAGGCTGGTATCTCCAAGGAGGGCCAGACTCGTGAGCACGCTCTGCTTGCCTTCACTCTGGGTGTGAAGCAGATGGTCGTCGC
CATCAACAAGATGGACGACTCGTCTGTCATGTACGGCCAGGCCCGTTACGAGGAGATCAAGTCTGAGGTCACCACGTACCTAAAGAAGGT
TGGCTACAAGCCCGCCAAGATCCCGTTCGTGCCTATCTCCGGCTGGGAGGGTGACAACATGATCGACCGCTCCACCAACATGCCGTGGTA
CAAGGGACCTTTCCTCCTTGAGGCTCTTGACAACCTGAACGCCCCCAAGCGCCCGTCGGACAAGCCGCTGCGT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan