ESTScan Details for Unigene SGN-U283423

Score 
138
Direction 
Reverse
Predicted Peptide Sequence 
NNAHWITVKPASHAXXIVNIGDQIQILSNAIYKSVEHRVMVNSVEERISLAFFYNPKSDLMIEPVKELLTTHNVSPLYPPRTFDQYRLYI
RTKGPQGKSQLGESNKLNPQHDKM
Predicted Coding Sequence 
XXCAACAACGCTCATTGGATCACTGTAAAACCAGCTTCTCATGCNNTTXTCATCGTCAATATAGGCGATCAAATTCAGATATTAAGCAAT
GCGATATACAAGAGCGTTGAGCATCGAGTGATGGTAAATTCGGTAGAGGAACGCATCTCCCTAGCGTTTTTCTACAATCCAAAAAGTGAT
TTGATGATAGAACCAGTAAAGGAGCTGCTCACCACACACAATGTTTCTCCATTGTATCCACCAAGGACTTTTGATCAGTATAGACTCTAC
ATAAGGACTAAAGGGCCTCAGGGAAAATCACAGTTAGGGGAATCAAATAAATTAAATCCCCAACATGACAAAATGTAA\
Edits in Original Sequence 
(5')XXCAACAACGCTCATTGGATCACTGTAAAACCAGCTTCTCATGCNNTTXTCATCGTCAATATAGGCGATCAAATTCAGATATTAAG
CAATGCGATATACAAGAGCGTTGAGCATCGAGTGATGGTAAATTCGGTAGAGGAACGCATCTCCCTAGCGTTTTTCTACAATCCAAAAAG
TGATTTGATGATAGAACCAGTAAAGGAGCTGCTCACCACACACAATGTTTCTCCATTGTATCCACCAAGGACTTTTGATCAGTATAGACT
CTACATAAGGACTAAAGGGCCTCAGGGAAAATCACAGTTAGGGGAATCAAATAAATTAAATCCCCAACATGACAAAATGTAA\(3')TTG
ATGTCTTTTTTTTTTGTTTTAATAATAATAATAGTGCCATACTAGCTGCTTGTATGGATTTCAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan